SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020391 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020391
Domain Number 1 Region: 317-408
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000367
Family Calponin-homology domain, CH-domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020391   Gene: ENSCAFG00000013840   Transcript: ENSCAFT00000021959
Sequence length 415
Comment pep:novel chromosome:CanFam3.1:X:31044315:31104634:1 gene:ENSCAFG00000013840 transcript:ENSCAFT00000021959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATHLDKQTIILKDDKDDSSVKSRDGVLLPYQEVGLSSPAPTKFNDAKPAERRLSVGIEI
IHERLNSGKSKTSKKDNDRSMEKEEKNEQCFSPEEGTKAYDFFEKVVNAAQTWFSLFGWP
EGPHCLSIPETIRREVYKIKFYSSTSSSKKISRQNDFSKYNKTIYDVMLHLSGKMPPGIN
SSQSLPEDYTERVIQLHSQHSSLLDFLITQGACISHVLPEFLLEPEDYKKWIEITSSTNT
LPACSCIPKEKHYIVIDMSQFEAWSKRSWTDVFLQIYKVLVLSRVVPHCSNNLPPIPVQN
SPKVNPCFSSSNIYSNPERILLNWMNTNYENARHIIWKNCHKGVIPSERWIVNFDRDLLD
GLVFATQLGAYCPFLIESHLVKMYTQPKSSEQYLHNCLIIVNVLHEIGFDMDIQV
Download sequence
Identical sequences E2QT92
9615.ENSCAFP00000020391 ENSCAFP00000020391 ENSCAFP00000020391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]