SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022544 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022544
Domain Number 1 Region: 335-456
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.97e-34
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022544   Gene: ENSCAFG00000015292   Transcript: ENSCAFT00000024286
Sequence length 459
Comment pep:novel chromosome:CanFam3.1:5:30567598:30583456:1 gene:ENSCAFG00000015292 transcript:ENSCAFT00000024286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGPDAEEARTVREALGRYEAALEGAVRALHEDMQGLQRGVERRVAEALRLAGPLARTV
AELQRDNQRLQSQLERLTRQVEALGLGTGQAPAAGSPGTHSPPAAPAAPGRAPRLGSARF
ASHATFSLSGRGQSVDFQDEAGEADARKASDPGIIENGHQPGAGSHAPGVGDGPAEAAET
FPAPEPPRPRPVSLSLGLPHQPVTAITRMPEKFSGETSAAALSPTSAAVLGALSLSPSEA
TTAWTAALSEKNPPAPCSSSSYGAASAGRNSNSLPQAMLPQSPPSPPPPATLQARRRELV
RSQTLPRTSGAQARKALFEKWEQDTAGKGRGEVRAKLKRSQSFGVASASSIKQLLLEWCR
KKTVGYQHVDLQNFSSSWSDGMAFCALVHSFFPDAFDYGALSPSQRQKNFELAFSTAENL
ASCERLIEVEDMMLMGRKPDPMCVFTYVQSLYNHLRRFE
Download sequence
Identical sequences E2RKS0
ENSCAFP00000022544 ENSCAFP00000022544 XP_005619927.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]