SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023286 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023286
Domain Number 1 Region: 22-144,176-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-76
Family Calponin-homology domain, CH-domain 0.0000352
Further Details:      
 
Domain Number 2 Region: 6180-6335
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-18
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 3 Region: 5960-6086
Classification Level Classification E-value
Superfamily Spectrin repeat 2.3e-17
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 4 Region: 5874-6006
Classification Level Classification E-value
Superfamily Spectrin repeat 5.9e-16
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 5 Region: 6603-6753
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000163
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 6 Region: 6089-6198
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000176
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 7 Region: 4898-5039
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000547
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 8 Region: 5746-5902
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000016
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 9 Region: 5054-5155
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000353
Family Spectrin repeat 0.0095
Further Details:      
 
Domain Number 10 Region: 5232-5365
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000131
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 11 Region: 6510-6633
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000317
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 12 Region: 5583-5693
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000877
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 13 Region: 3734-3881
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000024
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 14 Region: 3309-3466
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000134
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 15 Region: 2226-2351
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000345
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 16 Region: 2699-2831
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000023
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 17 Region: 5323-5463
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000432
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 18 Region: 2100-2214
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000755
Family Spectrin repeat 0.019
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000023286
Domain Number - Region: 1488-1603
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000106
Family Spectrin repeat 0.02
Further Details:      
 
Domain Number - Region: 392-429,615-666
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000327
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 4819-4927
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00149
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 5166-5260
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00198
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 2800-2938
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00245
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 1911-2032
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00336
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 3214-3318
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00374
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 1782-1901
Classification Level Classification E-value
Superfamily Spectrin repeat 0.035
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023286   Gene: ENSCAFG00000015819   Transcript: ENSCAFT00000025088
Sequence length 6932
Comment pep:known chromosome:CanFam3.1:8:38373607:38644978:1 gene:ENSCAFG00000015819 transcript:ENSCAFT00000025088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSPVPPTEDEQVSLGIDDRHISLQAEQEDTQKKTFTCWINSQLAKHIPPSVVSDLFAD
IKKGHVLLDLLEVLSGQQLPRDKGSNTFQCRINIEHALTFLKNRSIKLINIHVTDIIDGN
PSIILGLIWTIILHFHIEELARTLSCNYNQPSLDSVSVADSSPTSSPPAKKCSRAQERWQ
MSAKKALLLWAQEQCASYESVNVTDFKSSWRNGMAFLAVIHALRPDLIDMKSVKHRSNKD
NLKEAFGIAEREFKIPKLLEPEDVDVANPDEKSIMTYVAQFLRYSKDAAETGDKTQGKMK
DAVAWLTLPEKKLPKVLKDSENETYSKKYEILLSFLESFNEEKKPFLDILPIKRNPAELS
EDQLQLREAWDGLNYQINVWKTELNHALPSPLHQIEAWLQEIEGLIDEDLPASQDYCEAM
ALIQEKMTLIKNLMDKFDCNSNTLLTFENRDEEHLPLVPPKKLEEMKGRINNISGKKLIP
RLEFHYYKCSVLGLLDELKLKLDVWNIKYGNKASVELLLEDWHKFIEEKEFLAQLESSFQ
KCEEIHKNLAGQHQDISEQYTAVEHNICMYRKNIYNVKSTLQKVLTCWATYVENLLLLKA
CFEETKKEQMKEVPFETLSQWNREHTTLNEVGNFLIQVSNDEVGSSISKELRRLNKRWRK
FITKTQLDMNLPLIKKQDQPNFDNYENTQLSKEEKPTVDFSTDMSIELPENHNENIKAGE
EREKENEFTGQLKVAEEIEKLIGQMEIWEAETKSLLDILRRQEGVDASVEESLQHLIAKG
SMYEELVSRTEDTLQMDVQNISSQESLQHVLTVGLQTKIQEAKEKVQINMVKLIAVLKNS
TDASPNLDVKLRVEESQKELESYMTRAEQLLGQKESRSGLISKYKEALIILNSKSLVKYL
KAVEELKNNVTEDVKLSLEEKSRSARAKWESLHQEMSLYIQQLKIDIEKEKLNDNISKLE
KQINKEKKLIRRGRTKGLIKEHEACFSEEASLYQLDHHMDVLRELCEELTSQKSQQEVRR
ALKDYEQKIERLRKCASEIHMTLQPTMGGTSKNKETTNPSENGGRDSHSEVPSVKSENQP
STEKAMDSIKNFSLESKLKPQPEENFMKKYEKDHNAALSSLQERHDMHRENLELYLEKNK
FRIISDFSSDKERSSACLQDKLTDLRVLKNEIDACWKEFEITSLKLEELDSDVKKPFISN
MRDKLKEKEREFQMTLNTRMESLETALKIVLPVEKESLLLCGSDLLLHELVIQEFHLIDI
DGIYQNLRNIQDSIAKQVEICNNVEQSGDFALKDLYPVDVHATQNITLKHKTQLEEANHK
VQRSKDALKALEEFLASLRTAELSFELSASDTQVVPEDTLTVENKKGEINLMKDQARHLD
ERLKMLGISFKDAERGDDTCDKLLDALFRKLFETRGYGVQEELTEENKLLETCILKNNEL
LRNIQDVYNQISKISLKDPTVPAVKQRKKSLMKLDKDLDEYEEEKKCLQEMVNSLPQFKD
GREKSLNQQFQNTVHLWESTKTSVTECLDQCERVLELLKQYQNFKSILTALIQKEESIIS
LQASYMGKENLKKRIAEIEIVKEEFNEHLEVVDKINQICRNLQFHLNKMRIFEEPPFEKE
ANIIVDRWLDINEKTEDYCENLGRALALWDKLFNLKNVIDEWTEKVLQKMELHQVAEEER
EKLKEELQVHEQKSSEFSKRVAKIQFLLQSSEMPLELQVMESSILNKLENVKMHLIGESN
CSALSGSTAELREDLDQAKTQMGMTESLLKALSPSDSLEIFTKLEEIQQQILQQKHSMML
LENQIGCLTPELSELKKQYESVSDLFNTKKSVLQDHFSKLLNDQCKNFNDWFGNIKMNLK
ECFESSETKKNVEQKLQKLSDFLTLEGRGSKIQQVGTVLNHVKKHLPKAHVKELNSWIIN
QEIELEKMDSICQTQAKELNDHLQQLLRLQDDHRNLSKWLTSQEEKWIEMEKSGEKTELF
CEAVAGKREQFESMAQLNSSLKEYGLTEEEEIIMESTHLIDRYQTFLRQLCEIDEEDKLP
PTEDQSFNDLAHDVIHWIAEIKESLMVLNSSEGKMPLEERIQKIKEIILLKPEGDAKIQT
IMSQAESSKAPLAPKTLTDIKNQWDNTLHLANTYLSHQEKLRLEGEKYLQSKEDLRLMLT
ELKKQQEAGFALQHGLQEKKAQLKIYKKFLQKAQDLTSLLKELKSQGSYLLECTKNPNFS
EKPWLEIKHLHESLLQQLQDSVQKLEGHVQEHHSYQVCVTDLNTALDDISKEFASFSDKP
VDQIAVEEKVQKLQELENRLRLQDGILKKILALAKSIKQNTSSGGQKIIKDDIKSLKCKQ
KDLENRLECAKQESENYLNSILKSERSTEQKEKFPLPGREKEVTSDVQEPTQDSAVPEKF
EEDREINKNSAVEVVLSKQLSLNVQESMKNTEDEHKVNELQNQPLELDVMLRNEQLKEIE
ELYALLEAKKIATEPLEQTECLNKAEASALVLHSTRYSVHHLDSLLQALITLKKKKESQY
ELLNNFQEHLAAVESSVKALLTEKESLKVGPLDSATYLAKIKQFLASIEKEKDPLSRMKT
EWENVSNCLTDMDKKLLESQIKQLVNSWEQVEQLAQKKYSQQVVEHDEFMLLMNQIQDLE
ISVQQQRQSLQLGLNSMEEQDGGLNTIALATELQNMKHQFSVLKGKAEFQMKRIWGEKEK
NALEDAMNNLQKQLEALEPLNIKVENQIKKCEVRNKMKEIIQWVKNLLGEVTPTISLFPD
DILSQIRKCKVKHDGILDKQQAVESLVEEVKKNIPNLTADESNDLNHLLQDLQNQYQMLI
LKSTERSQQLEFKLEERNRFIAVIEKLQLSLQENEAQIIPKMKTASTEPELEQEHVTLTS
SQEALQEAESVISARLQEQADVCKDLCVFERLFLGDQLKNLKTRANRTQRVIQNKCNEVE
RKIHFYREYHEKASVLQKEVDHIQHSELPLNQEIHEDVKEELYSLKDRITGVQSRILQVL
KLKEVFDSLGLNWDSSQLDQLQAQVFEKEKELEEKIKQLDTLVAERGKYQASLSKLRAMD
LQIKTRAEALLEMPHASPASSLLSAQILQRRIEKAMCLCQEMIKNLNQSKTFDDSFKEKE
ILQIKLCVEENDKLHKILQDKVLESQPKEMGEKNFQDKLESSIHVLNQIKSQLEQPLLIN
LDIEHIQNEKENCEAFQEQVQVEMDSLKAMTLIEKQREENSLETCEVETKLHDIEDLHMQ
LNTSIDLRTDVLNDAYESMTRYNEAITRAMGIFTACEAIVASHKVDLDNPEEPLEMSYWK
QEELQSTMADIQDLTEKLGTISSPEAKQQLQYTLQELVSKDSAMREAAKVKKSEIERCLE
NYKCYRKIKEKVCTNLSQMETVLGQSMFPLPVSYKEALERLEQSKALRSNLLSTKEEFME
LRQVLRHLRPMCTDSDDRCLLRTTLALWDKWLSLLEAAKEWELWCEELKQEWKFVSEEIE
REAIILDNLQEDLPEISKTKEAATTEELCDLQDCLCRYQENVEKQQLLLTLLFQRMRSIQ
NAPKSLEAVETSPTFQEITSMQKRCNKLFQKAQENKELMENEIQERHSFTKEMISLKNLF
QQTAASFQNMELQDHPERADQFEELQSIFKKGKLTFENIMEKLRMKYSEMYTLVPAEIES
QVEECRKALEDIDEKISNEVLKSSPSYTMSRKIDEINNGLHDVEKMLQQKSKNIEKAQEI
QKKMWDELDLWHSKLNELDSEVQDIVEQNPGQAQEWMDNLMIPFQQYQQVSQRAESRTSQ
VNKATVKMEEYHDLLKSTEAWIENTNRLLANPADYDSSKALSQHASTLQMALEDSEQKHN
ILHSIFTDLEDLSIIFETDDLAQSVQELNHQVAALQQKIMESLPQIQRVADDVVAIETEI
KSIEKKVSKIKAILLSKEIFDFSPEEHLKHGEVILENIRPMKKAIAELVSYQVELRWAQM
GMKPLPVFQRTNQLLQDIKLLENVTQEQNELLKIVIKQTDECNEEIENLKQILNNYSTEF
SHERISPDQTTNLPQVQGNIKGMEKQILSLTQKREDLLVDLKAAILNLHQHLQQDQQESE
QEMPSTGASEEEGVAERDASEWKLNKISSMSFLPALKEEVEESSLKSENGDKKAKPSSGS
LLWKHDGDMEEDRASSSSGTIIQEAVEKISTCDNPMAQILAPDSLSPNQTEEGATPTVKA
AALGFSNEQGAFETTVEKARSKPAEILHVCKTKVAELELWLRQANVAFEPETLNADMQQL
VEQQLVGCQAMLTDIEHKVASLLESCKDLGPGDSGATQQEAEALSLKLKTVKCNLEKVQI
MLQEKYSEDQHSTTLKKPSEHPNDLQADNLSEFESIVIERPQFGKQKDFQQQQVLELKPM
EQKDFIKFIDFNAKKMWPPYCQPDENVTQKSTESMRASSLENDAPGSVLSTQDESGDKWQ
YLHHELSSKIGLPPPKQVQPQVATNMSVLPNVSMYNFRYPTTEELKTYTTQLEDLRQDAN
NLQTQENMTEDTYINLNTKLFELFLTLSQCLGSVEEMLQTPGLSREDVCAQQAHYETLAL
ELKKLYLAMGDKKDDLVKAMTWPERNTSLFLECFNNLQVYLEHTQIAAASRSKSLKAGLD
YNRSYQNEIKRLYDQLIKNKTSLQQSLNEISGQSIDEQLQKADAYTVELQNSESRVAKLR
DEGERLHLPYALLQEVYKLEDVLDSMWGILRARSTELSSPCITERQENALLRGMVELVDI
GKEKLAHDHLQQAKSKAALQAQIQNHKLFFQKLVADMLLIQTYSNKMLPSLLQKKETFWA
EQIKEIKSLEERSHQCGIKLQSLLQKWEEFDENYTSLEKDLEILVSTLPSVSLVEETEER
LVERISFYQQIKRNIDEKHARLYQTLNEGKQLVASVSCPELEGQITKLEEQWLALNKKID
HELHRLQTLLKHLLSYNRDSDQLTKWLESSQQTLNYWKEQSLNVSQDLDTIRSNINNFFE
FSKELDDKSSLKTAVVSTGSQLLHLKEADTATLRASLAQFEQKWTMLITQLPDIQEKLHQ
LQMEKLPSRKAIMEMISWMNNVEHQTSDEDSECSLSSASQVKSLLQKYKEFRMEMDYKQW
IVDFVNQSLLQLSTCDVESKRYERTEFAEHLGEMNRQWHRVHGTLNRKIQHLEQLLESIS
ENENKIQILNNWMEAQEERLKTLQKPGSVISVQKMLLDCQDIENQLAIKSKALDELRQSY
LTSESGTMPLLEDTASRIDGLFQKRSSVINQVNELKTSMQSVLQEWKVYDKLYEEVTMMT
IRFWYCMDHSKPVVLSLEALRCQVQNLQSLQDEAESSEGSWEKLQEVIGKLKDHCPSVAE
IIEEKCQDTHARWTQVNQDIAEQLQKAQSLLQLWKAYNSAHTEAAARLEQQEAKYQQLEN
INMSGNNLAEILTSALQDVKELQQDVQKTKEAFLQNSTLLDRLTQLTESSTHVPLSTQLH
SLQRASYLEKMLLVKANEFEFVLSQFKDFGDQLESLKGLIMREEENLDKLYHQEKEENPD
LFLKHVLALTAQSPDVEHLNAVSLKLPLSDIAVKTLQNMNRQWIRATATALERCSELQGI
GLNEKFLYCCEKWVQLLEKIEETLKVNIGNSLPALLEQQKTYGMLEAEVSINQTIADSYV
TQCLQLLDTTEIEKRPEFISKFTKLKDQWQSAAQGIQQRKSDIDGLVGQWQYFTTSVDNL
LRFLTNTCHLLSAVKSQDCYGLHQTRRLIRELKSKEIHFQRQQTTFELTLEAGEKLLNTA
NLETQDLIEKKISQIRDDWENTKLQVGEMIQQLQSNVETWGQCEKKIKELKSRLQVIKAQ
SRDPLPELHEDLHREKELIKELEKSLGNWTQNLKELHTMKTHLTQHILVEDVLVLEEQTE
HLHRQWEDLCLRVAIRKQEIEDRLNSWIVFNEKNKELCAWLVQMENKVLQTADISIEEMI
EKLQKDCMEEINLFSENKLQLKQMGDQLIKASNKTRAAEIEDKLSKVNDRWQHLFDVIGS
RVKKLKETFAFIQQLDKNMSNLRTWLARIESELSKPVVYDVCDDQEIQKRLAEQQDLQRD
IEQHSAGVESVFNICDVLLHDSDACANETECDSIQQTTRSLDRRWRNICAMSMERRMKIE
ETWRLWQKFLDDYSRFEDWLKSAERTAAYPNSSEVLYTNAKEELKRFEAFQRQIHERLTQ
LELINKQYRRLARENRTDTASKLKHMVHEGNQRWDNLQKRVTAVLRRLRHFTNQREEFEG
TRESILVWLTEMDLQLTNVEHFSESDADDKMRQLNGFQQEITLNTNKIDQLIVFGEQLIQ
KSEPLDAVLIEDELEELHRYCQEVFGRVSRFHRRLTSHTPGLEEEKEASENETDMEDPRE
IQADSWRKRRESEEPSSPQSLCHLVPPAPGPERSGCETPVSVDSIPLEWDHTGDVGGSSS
HEDDEEGPYYSALSGKSISEDHSWHVPDSPSCPKHHYKQMGGDRNVQTIPSDSSTPYKPA
YVKLLLSPGTDGGKEGSRVLNGSSRQEDKGLAALTRQQSGAFDRWELIQAQELHNQLRIK
QNLQQLNSEISDITTWLKETEAELETLKAAEPPSDIWEMQLRVKRLKEILKAFDTYKALV
VSVNTSSQEFLQTESAESNELQSRVGQLGLRWDAAQGAVESWREGLRQSLMQCQDFHQLS
QDLLLWLASAESRRQKAHVTDPEADPQVLLECQGELMQLEKELVERQPPVNTLREISDSL
LSKGHGEDYIEAEEKVHVIEKKLNQLLEQVSQDLMSLQGSQNLDPSLPSLDEVDSGDQPP
GTSVPAPQAQQCGAERMTKDQNKMDSRVPGPAGPGSSRPQRSFVSRVIRAALPLQLLLLL
LLLLACLLPSSEEDYSCTQANNFARSFYPMLSTHLGGSQGGLRKMTRLPAPVAASVSQTL
QAASCNGYQLKRICLDVTKLMKVMGRKGYFAV
Download sequence
Identical sequences F1Q3V9
ENSCAFP00000023286 ENSCAFP00000023286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]