SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023629 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCAFP00000023629
Domain Number - Region: 252-314
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0267
Family Calponin-homology domain, CH-domain 0.015
Further Details:      
 
Domain Number - Region: 38-85
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.034
Family Calcium ATPase, transmembrane domain M 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023629   Gene: ENSCAFG00000016019   Transcript: ENSCAFT00000025448
Sequence length 359
Comment pep:known chromosome:CanFam3.1:18:54552601:54581570:-1 gene:ENSCAFG00000016019 transcript:ENSCAFT00000025448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPLLIGELAPEEPSQDHGKNSQITEDFRALRKTAEDMNLFKSDHLFFLLLLAHIIVMES
IAWFIIFYFGNGWISTVITAFVLATSQAQAGWLQHDYGHLSVYKKSMWNHVVHKFIIGHL
KGASANWWNHRHFQHHAKPNIFHKDPDVNMLHVFVLGEWQPIEYGKKKLKYLPYNHQHEY
FFLIGPPLLIPVYFQYQIIMTMIVRRDWVDLAWAMSYYVRFFITYIPFYGILGALLFLNF
IRFLESHWFVWVTQMNHIVMEIDREPYRDWFSSQLAATCNVEQSFFNDWFSGHLNFQIEH
HLFPTMPRHNLHKVAPLVKSLCAKHGIKYQEKPLLRALQDIIRSLKKSGELWLDAYLHK
Download sequence
Identical sequences F1PWZ5
XP_013976379.1.84170 ENSCAFP00000023629 ENSCAFP00000023629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]