SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023786 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023786
Domain Number 1 Region: 33-283
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.99e-92
Family Calponin-homology domain, CH-domain 0.00000306
Further Details:      
 
Domain Number 2 Region: 2174-2293
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-33
Family Pleckstrin-homology domain (PH domain) 0.0000189
Further Details:      
 
Domain Number 3 Region: 299-420
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-33
Family Spectrin repeat 0.0000942
Further Details:      
 
Domain Number 4 Region: 1644-1797
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-29
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 588-745
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-29
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 6 Region: 1536-1691
Classification Level Classification E-value
Superfamily Spectrin repeat 2.42e-28
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 7 Region: 1014-1168
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-27
Family Spectrin repeat 0.00000447
Further Details:      
 
Domain Number 8 Region: 1855-2009
Classification Level Classification E-value
Superfamily Spectrin repeat 2.54e-26
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 9 Region: 1233-1379
Classification Level Classification E-value
Superfamily Spectrin repeat 6.55e-25
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 10 Region: 819-952
Classification Level Classification E-value
Superfamily Spectrin repeat 9.84e-25
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 11 Region: 429-530
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-22
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 12 Region: 749-853
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-19
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 13 Region: 1351-1451
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000419
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 14 Region: 2015-2074
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000273
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023786   Gene: ENSCAFG00000016120   Transcript: ENSCAFT00000025613
Sequence length 2330
Comment pep:known chromosome:CanFam3.1:8:39159242:39221193:-1 gene:ENSCAFG00000016120 transcript:ENSCAFT00000025613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPANMTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQ
KKTFTKWVNSNLARVPCRITDLYKDLRDGRMLIKLLEVLSGEILPKPTKGKMRIHCLENV
DKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIIVQTQEGRETRSAK
DALLLWCQMKTAGYPQVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEH
AFDVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDH
AIETEKMIEKYSGLASDLLTWIEQTIVVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKF
QEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYQRELALRHELIR
QEKLEQLARRFDRKAAMRETWLNENQRLVVQDNFGYDLAAVEAAKKKHEAIETDTAAYEE
RVKALEDLAQELEKENYHDQKRITARKDNILRLWNYLQELLRTRRQRLEMTLALQKLFQD
MLHSIDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATRQFAE
EKGYQPCDPQVIQDRVSHLEQCFEELSNMAAGRKAQVEQSKRLWKFFWEMDEAESWIKEK
EQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDTHLGQIFQEAEGMVARKQFGYPQIEV
RIKEVSAQWDQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEG
ATRALGKKHKDFLEELEESRGVMEHLEQQAQGFPQEFRDSPDVTNRLQALQELYQQVVAQ
ADLRRQRLQDALDLYTVFGETDACELWMGEKEKWLAQMQIPDTLEDLEVAQHRFDILDQE
MKTLMTQIDGVNLAANSLVDSGHPRSGEVKQYQDHLNARWQAFQTIVSDRRGAVNSALRV
RNYCVDCEETSKWIEDKMQVVQSIKDLGQDLTGIISIQRKLSGLERDVAAIEARVGALER
ESQQLMASHPEQKEDIGQRQACVEKLWQELQEALKEQEASLGEASQLQAFLQHLDNFQTW
LSMAQKAVASEDMPESLPEAEQLLQQHVAIKDEIDGHRGDYQQVKASGENVIRDQTDPEY
LLLGQRLEGLDSGWDALCRMWESRNHSLAQCLGFQEFQRDAKQAEAILSNQEYTLAHVEP
PDSLEAAEAGIRKFEDFLVSMENNEDKVLSPVDSGNKLVADENLYSDKILEKVQLIEDRH
RKNKEKASEASIILKDNLELQNFLQNCQELTLWINDKLLTSQDVSYDDARNLQNKWAKHQ
AFMADLASHQGWLDSIDAEGKQLMEEKAQYAARVSQRLEDLHRLWDELQAATQERAQHLS
AARSSYLRSQTHADLSKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELG
ELFAQVPSLGEEAGDADMSIEKRFLDLLEPLERRKKQLESSRAKLQISRDLEDETLWVEE
RLPLAQSANYGTNLQTVQLLMKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDIE
ERLGHLQGSWDTLREAAAGRLQRLRDASEAQQYYLDAGEAEAWISEQELYIISDEIPKDE
EGAIVMLKRHLRQQHTLEEYGRNIKQLAGRAQSLLSAGHPEGEQIIRLQGQVDKHYAGLR
DVAEERRRKLENMYHLFQLKREADDLEQWIAEKELVASSPEMGQDFDHVTLLRDKFRDFA
RETGAIGQERVDNVNLIIEQLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAAS
YDLHRYFYTGTEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELQLLGLQVQQFQ
DVATRLQTAYAGEKAEAILNKEQEVTAAWQALLDACAGRRTQLVDTADKFRFFSMVRDLL
SWMENIIRQIETQEKPRDVSSVELLMKYHQGIKAEIDTRSKNFSACLELGESLLQRQHQA
SEEISEKLKQVLSRRKEMNEKWEARQEQLRMLLEVCQFSRDASVAEAWLIAQEPYLASRD
FGHTVDSVEKLIRRHEAFEKSTASWAERFAALEKPTTLELKERQTPERPEEESGPQEEEG
ETAGEAPRGPHRTTTERTSPGEEERQWPQDLQPPLPPGPQEKSSGDERPATEPLFKVLDT
PLSEGDEPTTLPAQRDHGYSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELTFY
KDAKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEMLS
WLQGVSTAINESQSIRVKAQSLPLPSVAGPDASLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences F1Q253
ENSCAFP00000023786 ENSCAFP00000023786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]