SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023883 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023883
Domain Number 1 Region: 389-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-37
Family Calponin-homology domain, CH-domain 0.0000884
Further Details:      
 
Domain Number 2 Region: 87-241,386-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.19e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.072
Further Details:      
 
Domain Number 3 Region: 756-789
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000238
Family LIM domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000023883
Domain Number - Region: 790-818
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000713
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023883   Gene: ENSCAFG00000016211   Transcript: ENSCAFT00000025716
Sequence length 2016
Comment pep:novel chromosome:CanFam3.1:27:45406470:45595409:-1 gene:ENSCAFG00000016211 transcript:ENSCAFT00000025716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSKNETVNHAHVLFDRFVQATTCKGTLKAFQELCDHLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLVQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELKEATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVILHDYADTELLLSRENVDQEALLNYAREAADFSTQQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGTSPLEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNININFLR
PSQVRHLYNTGETRDIHLEMENLVNSRTTPKLTRNESVARSSKLLGWCQRQTDGYAGVNV
TDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKE
MASVGEPDKLSMVMYLTQFYEMFKDSLPSSDALDLNAEEKAVLIASTKSPISFLSKLGQT
ISRKRSPKDKKEKDLDGAGKRRKTSQSEEEEAPRGYRGGRPTLVSTLTDRRMDVALGNQN
KVKYMATQLLAKFEENAPPQSTGMRRQGSIKKEFPQNLGGSDTCYFCRKRVYVMERLSAE
GKFFHRSCFKCEYCATTLRLSAYAYDIEDGKFYCKPHYCYRLSGSAQRKRPAVAPLSGKE
AREPLQDGPTVDTNGRASAVTSPAERTPGSSVNGVEEPSIAKRLRGTPERIELENYRLSV
KQAEELEEVPEETQAEHNLSSVLDTGAEEDVASSSSESEMEEEEEEEPPLPTSDLGGVPW
KEAVRIHALLKGKSEEELEASKSFGPGHEEDEEEEEYEEEEEEEEEEYEEEEEEEESSEV
GSQRLQQIVNPADPLEIQADVHWTHIREREEEERMVPTSESSTSRVPFDENDLEEDVDSE
PAKIEGEATENGDTGDTGAELDDDQRWSDGIPSDAETDLRVQHQEAVEADLELRVSENEE
EPPEVTPGHPERSLTRVPSPALSPEEQAGLRSPGHSPKAEGAQIPLVSVVTKAKLPEENL
FPKPLLPKVKPKVEVPCSQRAACSPIRSQPVALPEARTPTSPVSSQCLSPLATSTPTSTQ
LPICSQPQPSSETTAPSPTKSPIRLQPVSAKTSIPVVPLPLKNQGDTKDRLGSPLAVDEA
LKRNDLVAEFWMKSAEIRRSLGLTPVDRSKVYEPSFPSPAFKPVSLKSYAVEKSPEGEGL
QLLKPPPVPKRLGLPKSDGDQPFLPTPKSPSDRELKSSQEERRDLSSSSGLGLHGSSSNM
KTLGSQSFNTSDSTMLTPPSSPPPPPPQDEEPATLRRKPYQTHEHKDAEPKASVIPPPPP
ATFMRAPREPTQPLQEEMRKSFVESVDEIPFADDVEDTYDDKTEDSSLQEKFFTPPSYWP
RTERPLHPPLAKENGRLPTLESGVQPQKRGLPLVSPEAKELAEERMRAREKSVKSQALRD
AMAKQLSKMKEMEMAAGTSSPPGGTSHKASSVPSKGKDLSPESPRRPVLKGPREPALKHE
ATSEEVLSPPSDSGGPDGSVTSSEGSSGKSKKRSSLFSPRRNKKEKKSKGEGRPPEKPSP
SLLEEAAAKPKSLWKSVFSGYKKDKKKKGDDKSCSSTPSSGATVDSGKHKMSPVVRAELH
LRRQLSFSEDSDLSSDDILERSSQKSRREPRTYTEEELNAKLTRRVQKAARRQAKQEELK
RLHRAQIIQRQLEQVEEKQRQLEERGVAVEKALRGEAGMGKKDDPKLMQEWFKLVQEKNA
MVRYESELMIFARELELEDRQSRLQQELRERMAVEDHLKTEEELSEEKKILNEMLEVVEQ
RDALVALLEEQRLREKEEDKDLEAVMLSKGFSLNWS
Download sequence
Identical sequences F1Q0K3
ENSCAFP00000023883 XP_013963865.1.84170 ENSCAFP00000023883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]