SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024336 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024336
Domain Number 1 Region: 10-249
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-86
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 267-389
Classification Level Classification E-value
Superfamily Spectrin repeat 6.24e-34
Family Spectrin repeat 0.000000618
Further Details:      
 
Domain Number 3 Region: 503-624
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-31
Family Spectrin repeat 0.00000366
Further Details:      
 
Domain Number 4 Region: 390-498
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-27
Family Spectrin repeat 0.0000029
Further Details:      
 
Domain Number 5 Region: 627-739
Classification Level Classification E-value
Superfamily Spectrin repeat 9.93e-23
Family Spectrin repeat 0.00000225
Further Details:      
 
Domain Number 6 Region: 738-840
Classification Level Classification E-value
Superfamily EF-hand 4.95e-19
Family Calmodulin-like 0.04
Further Details:      
 
Domain Number 7 Region: 843-913
Classification Level Classification E-value
Superfamily EF-hand 1.41e-18
Family EF-hand modules in multidomain proteins 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024336   Gene: ENSCAFG00000016534   Transcript: ENSCAFT00000026208
Sequence length 914
Comment pep:novel chromosome:CanFam3.1:8:42710290:42808378:-1 gene:ENSCAFG00000016534 transcript:ENSCAFT00000026208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC
ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMT
YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR
APENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRM
VSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKIC
DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT
IEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
NGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFAAQANVIGPWIQTKMEEIGRISIEM
HGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQL
LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGY
DIGNDPQKKTGMMDTDDFRACLISMGYNMGEAEFARIMSIVDPNRLGVVTFQAFIDFMSR
ETADTDTADQVMASFKILAGDKNYITVDELRRELPPDQAEYCIARMAPYSGPDAVPGALD
YMSFSTALYGESDL
Download sequence
Identical sequences E2QY08
ENSCAFP00000024336 XP_004397653.1.74151 XP_012416868.1.74151 XP_853103.1.84170 ENSCAFP00000024335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]