SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024510 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024510
Domain Number 1 Region: 933-1062,1094-1308
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.45e-72
Family p120GAP domain-like 0.00057
Further Details:      
 
Domain Number 2 Region: 6-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.09e-37
Family Calponin-homology domain, CH-domain 0.0000235
Further Details:      
 
Domain Number 3 Region: 650-679
Classification Level Classification E-value
Superfamily WW domain 0.0000205
Family WW domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000024510
Domain Number - Region: 761-825
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00069
Family Motor proteins 0.029
Further Details:      
 
Domain Number - Region: 704-768
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0138
Family Motor proteins 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024510   Gene: ENSCAFG00000016616   Transcript: ENSCAFT00000026393
Sequence length 1471
Comment pep:novel chromosome:CanFam3.1:7:41384388:41416973:1 gene:ENSCAFG00000016616 transcript:ENSCAFT00000026393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEQRRQNVAYQYLCRLEEAKRWMEACLKEELPSPVELEESLRNGVLLAKLGHCFAPAVV
PLKKIYDAEQLRYQATGLHFRHTDNINFWLSAIAHVGLPSTFFPETTDIYDKKNMPRVVY
CIHALSLFLFRLGLAPQIHDLYGKVKFSAEELSNMASELAKYGLQLPAFSKIGGILANEL
SVDEAAVHAAVLAINEAVERGVVKDTLAALQNPSALLVNLQEPLAPIYQELLAQAKAEKA
ASAQTHDGGESWDLYDCFLTQAEIQGNINHVNVHAALEVVDDALERQSPDALLEALLDPA
LALRGVRKDFTNWYLEQLSSDREQKAQELGLLDLLEKEEVQAGVVTANMKGDEEQAMFQA
VCRINRAIQKGVAADTVKELMCPEAQLPPVYPSASAVYQQELTALQQQRGGELGHEELFV
AMEMLSAVVLINRALEAGDGDSCWSSLVNPTTGLAEVERENAHRYFDALVELRHERMPDG
VTLSWNDLQATVYQVNAQVQEETNQILAVSLINEALDQGSPKKTLSALLLPSAGLDNVSL
AVAPRYHLLLVAAKRQKAQATGDPGAVLWLEEIRQEVLRANQDTDAAQRMALGVAAINQA
IKEGKAAQTEQVLRNPTVALRGVVPNCADSYQRALEGAMARKRYPGDTAFWVQHNMKDGS
TYYFHLQTFQGTWERPSGCRLNMSHLTREEIQSAITKVTAAHDRQQLWKANVGFIIQFQA
RLRGFLVREKFAEQSHFLRTWLPAVIKIQAHWRGYRQRKTYLERLQYFRANLDAVIKIQA
WVRMWAACRRYRRRLGYFQKNVNAIVKIQAYFRAWKARDDYRVLVHSPHPTVSVVCRFAH
LLNQSQEDFMVEAELLKLQEEVVRKIRSNQQLQQDLDLMDIKIGLLVKNRITLQEVVSHC
KKLTKKNKEQLSGMMVLDKQKGLKSLSKEKRQKLEAYQHLFYLLQTQPIYLAKLTFHMPQ
NKTTKFMESVIFSLYNYASNRREAYLLLQLFKTMLQEEIRSKVEQPQDMVTGNPTVVRLV
VRFYRNGRGQSALREILGRVIQEVLEDKRLSVHTDPIHLYKSWINQSEAQTGQRSHLPYD
VTPEQALSHPEVQRRLDISLHSLLAVTDKFLVAIMSSVDRIPYGMRYVAKVLRTTLAEKF
PDNSENEVYKVVGNLLYYRFLNPAIVAPDAFDIVAMAAGGALATPQRHTLGAVAQVLQHA
AAGKVFSGESRHLRALNDYLEETHLKFRRFVCRACQVPEPEERFAMDEYSDMVAVAKPVV
YITFGELVNTHRLLLEHQDWIAPDHCDPLHELLEDLGELPTVPDLIGEGVAADGNLDLSK
LEVSLTLANKFEGLETDTGDANAQSLLLSTKQMLADIMQFQPRDSLEEMLSLPLSREQEA
AHQRLMCQRQACETQIPEPLRRHRSLIAHSLLPLADKRRRVLRNLRQLEGLGLVSARNGY
QGLVDGLAKVAIRGGVRGGAGREGGLGGAGW
Download sequence
Identical sequences F6Y6X6
ENSCAFP00000024510 ENSCAFP00000024510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]