SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000025535 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000025535
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.89e-51
Family Calponin-homology domain, CH-domain 0.00000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000025535   Gene: ENSCAFG00000017326   Transcript: ENSCAFT00000027457
Sequence length 297
Comment pep:known chromosome:CanFam3.1:20:49830532:49837477:-1 gene:ENSCAFG00000017326 transcript:ENSCAFT00000027457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIIL
CEFINKLQPGSVKKVNESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQV
QSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPEKLREGRNIIGLQMGTNKFASQQGMT
AYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT
LNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHPHNYYNSA
Download sequence
Identical sequences A0A212D1F0 E2RB32 Q7YRL2 T0MGK6
9615.ENSCAFP00000025535 ENSCAFP00000025535 ENSOARP00000019989 NP_001009456.1.54773 NP_001009456.1.66739 XP_005682448.1.57651 XP_010976584.1.51371 XP_020749969.1.74333 XP_542053.1.84170 ENSCAFP00000025535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]