SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000025983 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000025983
Domain Number 1 Region: 6-208
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.48e-70
Family Calponin-homology domain, CH-domain 0.00000068
Further Details:      
 
Domain Number 2 Region: 3052-3175
Classification Level Classification E-value
Superfamily EF-hand 7.57e-53
Family EF-hand modules in multidomain proteins 0.000000579
Further Details:      
 
Domain Number 3 Region: 3177-3273
Classification Level Classification E-value
Superfamily EF-hand 6.8e-40
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 4 Region: 2028-2182
Classification Level Classification E-value
Superfamily Spectrin repeat 5.14e-24
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 5 Region: 969-1126
Classification Level Classification E-value
Superfamily Spectrin repeat 4.24e-23
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 6 Region: 3253-3341
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 7 Region: 2492-2653
Classification Level Classification E-value
Superfamily Spectrin repeat 2.68e-20
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 8 Region: 495-633
Classification Level Classification E-value
Superfamily Spectrin repeat 2.47e-19
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 9 Region: 2718-2845
Classification Level Classification E-value
Superfamily Spectrin repeat 3.91e-18
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 10 Region: 1187-1341
Classification Level Classification E-value
Superfamily Spectrin repeat 4.6e-18
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 11 Region: 2868-3006
Classification Level Classification E-value
Superfamily Spectrin repeat 6.28e-18
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 12 Region: 312-420
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-18
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 13 Region: 1493-1648
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000106
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 14 Region: 1602-1746
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000013
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 15 Region: 2175-2291
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000224
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 16 Region: 388-487
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000792
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 17 Region: 1797-1941
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000864
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 18 Region: 749-905
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000196
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 19 Region: 3014-3051
Classification Level Classification E-value
Superfamily WW domain 0.0000000000341
Family WW domain 0.00012
Further Details:      
 
Domain Number 20 Region: 2258-2388
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000979
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 21 Region: 2434-2509
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000266
Family Spectrin repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000025983
Domain Number - Region: 889-981
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000223
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 1402-1529
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00132
Family Spectrin repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000025983   Gene: ENSCAFG00000023562   Transcript: ENSCAFT00000027940
Sequence length 3652
Comment pep:known chromosome:CanFam3.1:X:26290714:26912934:-1 gene:ENSCAFG00000023562 transcript:ENSCAFT00000027940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKKFGKQHIENLFSDLQDGRRLLDLLEGLTGQKLPKEKGSTRVHALNNVNKALRVLQKNN
VDLVNIGSTDIVDGNHKLTLGLIWNIILHWQVKNVMKNIMAGLQQTNSEKILLSWVRQST
RNYPQVNVINFTTSWSDGLALNALIHSHRPDLFDWNSVVCQQSATQRLEHAFNIAKYQLG
IEKLLDPEDVATTYPDKKSILMYITSLFQVLPQQVSIEAIQEVEMLPRPSKVTREEHFQL
HHQMHYSQQITVSLAQGYERAPSSPKPRFKSYAYTQAAYVTTSDPTRSPLPSQHLETPED
KSFGRSLTETEANLDSYQTALEEVLSWLLSAEDALQAQGEISNDVEEVKEQFHTHEGYMM
DLTSHQGRVGNVLQLGSQLIGTGKLSEDEETEVQEQMNLLNSRWECLRVASMEKQSNLHK
VLMDLQNQQLKELNDWLTKTEERTRKMEKEPLGPDIEDLKRQVQQHKVLQEDLEQEQVRV
NSLTHMVVVVDESSGDHATAALEEQLKVLGDRWANICRWTEDRWVLLQDILLKWQRFTEE
QCLFSAWLSEKEDAVNKIHTTGFKDQSEVLSNLQKLAVLKTDLEKKKQTMDKLCSLNQDL
LSALKNTVVAHKMEAWLDNFAQRWDNLVQKLEKSSAQISQAVTTTQPSLTQTTVMETVTM
VTTREHILVKHAQEELPPPPPQKKRQIIVDSEIRKRLDVDITELHSWITRSEAVLQSPEF
AIYRKEGNFSDLKEKVNAIEREKAEKFRKLQDASRSAQALVEQMVNEGVNADSIKQASEQ
LNSRWIEFCQLLSERLNWLEYQNNIITFYNQLQQLEQMTTTAENWLKTQPTTTSEPTAIK
SQLKICKDEINRLSALQPQIERLKIQSIALKEKGQGPMFLDADFVAFTNHFNQVFADVQA
REKELQTIFDSLPPMRYQETMSTILTWIQQSETKLSIPQVTVTEYDIMEQRLGELQALQS
SLQEQQNGLNYLSTTVKEMSKKAPLSDISRKYQSEFEEIEGRWKKLSSQLVEHCQKLEEQ
MAKLRKIQNHIKTLKKWITEVDVFLKEEWPALGDSEILKRQLKQCRLLVNDIQTIQPSLN
SVNEGAQKMKNEAEPEFAGRLETELRELNTQWDYMCRQVYARKEALKGGLDKTVSLQKDL
SEMHEWMTQAEEEYLERDFEYKTPDELQTAVEEMKRAKEEAQQKEAKVKLLTESVNSVIA
QAPPAAQEALKKELDTLTTNYQWLCTRLNGKCKTLEEVWACWHELLSYLEKANKWLSEVE
VKLKTTENISGGAEEIAEVLDSLENLMQHSEDNPNQIRILAQTLTDGGVMDELINEELET
FNSRWRELHEEAVRRQKLLEQSIQSAQEIEKSLHLIQESLSSIDKQLAAYIADKVDAAQM
PQEAQKIQSDLTSHEISLEEMKKHNQGKETAQRVLSQIDVAQKKLQDVSMKFRLFQKPAN
FEQRLQESKMILDEVKMHLPALETKSVEQEVVQSQLNHCVNLYKSLSEVKSEVEMVIKTG
RQIVQKKQTENPKELDERVTALKLHYNELGAKVTERKQQLEKCLKLSRKMRKEMNALTEW
LAATDMELTKRSAVEGMPSNLDSEVAWGKATQKEIEKQKVHLKSVTEVGEALKTVLGKKE
MLVEDKLSLLNSNWIAVTSRAEEWLNLLLEYQKHMENFDQNVDYITNWIIQADALLDESE
KKKPQQKEDILKRLKAEMNDIRPKVDSTRDQAANLMANRGDHCRKVVEPKISELNHRFAA
ISHRIKTGKASIPLKELEQFNSDIQKLLEPLEAEIQQGVNLKEEDFNKDMSEDNEGTVKE
LLQRGDNLQQRITDERKREEIKIKQQLLQTKHNALKDLRSQRRKKALEISHQWYQYKRQA
DDLLKCLDDIEKKLASLPEPRDERKIKEIDRELQKKKEELNAVRRQAEGLSEDGAAMAVE
PTQIQLSKRWREIESKFAQFRRLNFAQIHTVHEESVVAMTEDMPLEISYVPSTYLTEITH
VSQALSEVEELLNAPDLCAQDFEDLFKQEESLKNIKDSLQQISGRIDIIHNKKTAALHSA
TPAERAKLQEALSRLDFQWERVNNMYKDRQGRFDRSVEKWRRFHYDMKILNQWLTEAEQF
LKKTQIPENWEHAKYKWYLKELQDGIGQRQSVVRVLNATGEEIIQQSSKTDASILQEKLG
SLNLRWQEVCKQLAERKKRLEEQKNILSEFQRDVNEFVLWLEEADNVANIPLEPGNEQQL
KEKLEQVKLLAEELPLRQGILKQLNETGGTVLVSAPLSPEEQDKLENKLKQTNLQWIKVS
RNLPEKQEEIEAHVKDLGQLEEQLNHLLLWLSPIRNQLEIYNQPNQTGPFDIKEIEVAVQ
AKQPDVEGILSKGQHLYKEKPATQPAKRKLEDLSSDWKVVTQLLQELRAKQPGPAPGLTT
VRALPIQTVTLVTQPAVTKETAISKLEMPSSLLLEVPALADFNRAWTELTDWLSLLDRVI
KSQRVMVGDLEDINEMIIKQKATLQDLEQRRPQLEELITAAQNLKNKTSNQEARTIITDR
IERIQSQWDEVQEHLQNRRQQLNEMLKDSTQWLEAKEEAEQVLGQARAKLESWKEAPYTV
DAIQKKITETKQLAKDLRQWQINVDVANDLALKLLRDYSADDTRKVHMITENINASWASI
HKRLSEREAALEETHRLLQQFPLDLEKFLAWLTEAETTANVLQDATHKERLLEDSKGVRE
LMKQWQDLQGEIEAHTDIYHNLDENGQKVLRSLEGSDDAALLQRRLDNMNFKWSELRKKS
LNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDELSRQAPIGGDFPAVQKQNDVHRAFKR
ELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQEPRELPPEERAQNVTRLLRKQAEEVNT
QWEKLNVHSADWQRKIDEALERLQELQEATDELDLKLRQAEVIKGSWQPVGDLLIDSLQD
HLEKVKALRGEITPLKENVSYVNDLARQLTTLGIQLSPYNLNTLEDLNTRWKLLQVAIED
RIRQLHEAHRDFGPASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQ
SLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQVINC
LTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLED
KYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK
PEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFN
YDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMG
YLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQLSHDDTHSRIEHYASRLAEMENSNGS
YLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILISLESEERGELERILADL
EEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAEAKLLRQHKGRLE
ARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVG
SQTSESMGEEDLLSPPQDTSTGLEEVMEQLNHSFPSSRGRNTPGKPMREDVI
Download sequence
Identical sequences F1P7G4
ENSCAFP00000031637 ENSCAFP00000025983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]