SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026490 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026490
Domain Number 1 Region: 84-213
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-49
Family Calponin-homology domain, CH-domain 0.000000574
Further Details:      
 
Domain Number 2 Region: 283-343
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 7.59e-19
Family EB1 dimerisation domain-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026490   Gene: ENSCAFG00000017942   Transcript: ENSCAFT00000028481
Sequence length 367
Comment pep:novel chromosome:CanFam3.1:7:54847450:55001777:-1 gene:ENSCAFG00000017942 transcript:ENSCAFT00000028481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQNRDQKYPPSQRYSSSRQPGREPGCSSPPRFVPFLGSAPMPGPTQTLSPNGENNNDII
QDNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQ
LCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLV
KGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANS
PTAGAAKSSPASKPGSTPSRPSSAKRASSSSSASRSDKDLETQVIQLNEQVHSLKLALEG
VEKERDFYFGKLREIELLCQEHGQENDDLVQRLMEVLYASEEHEGHPEEPEAEDQVHEQQ
PQQQEEY
Download sequence
Identical sequences E2RFG1
ENSCAFP00000026490 ENSCAFP00000026490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]