SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026721 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026721
Domain Number 1 Region: 952-1057
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.97e-31
Family Calponin-homology domain, CH-domain 0.00019
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000026721
Domain Number - Region: 678-780
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000419
Family Myosin rod fragments 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026721   Gene: ENSCAFG00000018081   Transcript: ENSCAFT00000028728
Sequence length 1059
Comment pep:novel chromosome:CanFam3.1:5:40000230:40046543:-1 gene:ENSCAFG00000018081 transcript:ENSCAFT00000028728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSAAKPWSPVIKAGSHGPDRARPLPAASSGMKSSKSSTSLAFESRLSKLKRASSEDMLN
KPGSTATSGVVRLKKTSTAGAISELAENRLRSNPGAVTTTKRTGIPAPRELSVTVSRERT
VPRGPSNPRKSVSSPTSSSTPTPTKHLRTVSTRPKQENEVGEKAVLESQVRELLAEAKAK
DSEINKLRSELKKCKERRTPSTEGADMSDSNLDGTSILPSDSEPLVRALEEKNKNFQKEL
ADLEEENRALREKLTYLEHSPNSDGGTSPTGESSCPTSMTQESSFGSPPGNQLSGEVDEY
RSNIHEHALRPSGSSSSDVTKASLSPDASDFEHITADTPSRPLSSTSNPFKSSKCSTTGS
SPNNASELSLASLTEKIQKMEENHHSTAEELQATLQELSDQQQMVQELTAENEKLVDEKT
LLETSFHQHRERAEQLSQENEKLLNLLQERVKNEEPDIQEGKILELEQKCAEILDQGRFE
REKLLNIQQQLTCSLRKVEEENQGALEMIKHLKEENEKLNGFLELERRNNGSMAKTLEEC
KATLEGLRIENGSLKAHLENEKQKAMETSPMAQTAEGREVQEMLRVARAEKDQLEHSCAE
LKQELVKAHAEIKHVSSLLAKVEKDYSYLKDLCDHQAEQLSRTSLKLQEKASESDAEIKD
MKETIFELEDQVEQHRAVKLHNNQLISELESNVMKLEEQKSDLERQLKTLTKQIKEETEE
WRRFQADLQTAVVVANDIKCEAQQELRTVKRRLLEEEEKNARLQKELGDMQGHSRPVNED
SEPPEVDAPSRWHGVYMNRTSPTPSESATTVKSLIKSFDLGRPGGVGQNISVHKGPRSPL
SGIPVRTAPAAAVSPMQRHSTYNSVRPASKGVTQRLDLPDLPLSDLLKGRSEDLKPDPYL
RKSPSLESLSRPPSLGFGNTRLLSASTGGLKPQSKLSVERRDPLAALAREYGGSKRNALL
KWCQKKTEGYANIDITNFSSSWSDGLAFCALLHTYLPAHIPYQELNSQEKKRNLLLAFEA
AESVGIKPSLELSEMLYTDRPDWQSVMQYVAQIYKYFET
Download sequence
Identical sequences F1Q150
XP_005620165.1.84170 XP_005620166.1.84170 ENSCAFP00000026721 ENSCAFP00000030594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]