SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027014 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027014
Domain Number 1 Region: 1029-1168
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.41e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000171
Further Details:      
 
Domain Number 2 Region: 160-244
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000146
Family Calponin-homology domain, CH-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027014   Gene: ENSCAFG00000018288   Transcript: ENSCAFT00000029051
Sequence length 1174
Comment pep:novel chromosome:CanFam3.1:20:52381715:52391203:1 gene:ENSCAFG00000018288 transcript:ENSCAFT00000029051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHVPSELWEPFYTDQYAQEHVKPPVTRLLLSAELYCRAWRQALPQLEPPPSPSALLALLA
RRGTVPALPERPVQEADLRHQPILMVGPAPPRLGARTHLVTCALTPTIRRLQEKTEQEAA
QRASPVAPADGVAPAQPSIRYRKDRAVARRAPCFPTVTTLQDLASGAALAATIHCYCPQL
LRLEEVCLKDPMSVADSLYNLQLVQDFCASRLPRGCPLSLEDLLYVPPPLKINLVVLLAE
MFMCFEVLKPDFVQAKDLPDGHAASPRASEASPAQNSSGCSSPVFNFRHPLLSPGGPQSP
LRGSTGSLKSSPSMSHMEALGKAWNRQLSRPLSQAVSFSTPFGLDSDVDVVMGDPVLLRS
VSSDSLGPPRPVPARTPVQPPPEPGDLPTIEEALQIIHSAEPRLLPDGAADGSFYLHSPE
GSSKLPLASSYPLEGASKPLPDGPTKVPTYVPHPEGPLKPSPCPAGEVSKPLALSEGSPK
AAASSPAAGNSEVKMTSFAERKKQLVKAEAEAGSPAATPTAPEALSSEMSELGARLEEKR
RAIEAQKRRIEAIFAKHRQRLGKSAFLQVQPREAGGEAEAEPGLVPGGERPAGEGQGEPS
PRPKAVTFSPELGPVPPEGLGDYNRAVSKLSAALSSLQRDMQRLTDQQQRLLAPPEAPGP
APPPAAWVIPGPTAGPKAASPSPARRAPAARRSPGPGPSPTPRSPKHARPAELRLAPLTR
VLTPPHDVDSLPHLRKFSPSQVPVQTRSSILLAEGSPPEEPVARPGLIEIPLGSLEEPTA
EDEGDGSPPGAEDSLEEEASSEGEPRAGLGFFYKDEDKPEDEMAQKRASLLERQQRRAEE
ARRRKQWQEAEKEQRREEAARLAQEEVTSGPPAPPAPVAPSATPAPAARAPVEEEVGPRR
GDFTRLEYERRAQLKLMEDLDKVLRPRAAGTGEPGQDRRKAPGPRSGCCDSTLARSPARG
LLGSRLSKVYSQSTLSLSTVANEAPHNLGVKRPTSRAPSPSGLMSPSRLPGSRERDWENG
SNASSPASVPEYTGPRLYKEPSAKSNKFIIHNALSHCCLAGKVNEPQKNRILEEIEKSKA
NHFLILFRDSSCQFRALYTLSGETEELTRLAGYGPRTVTPAMVEGIYKYNSDRKRFTQIP
AKTMSMSVDAFTIQGHLWQSKKPTTPKKGSSTPK
Download sequence
Identical sequences F1PUU3
ENSCAFP00000027014 ENSCAFP00000027014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]