SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027443 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027443
Domain Number 1 Region: 170-375
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-54
Family DBL homology domain (DH-domain) 0.00000000467
Further Details:      
 
Domain Number 2 Region: 2-235
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.16e-48
Family Calponin-homology domain, CH-domain 0.0037
Further Details:      
 
Domain Number 3 Region: 380-542
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-33
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 
Domain Number 4 Region: 633-753
Classification Level Classification E-value
Superfamily SH2 domain 1.94e-26
Family SH2 domain 0.00068
Further Details:      
 
Domain Number 5 Region: 780-839
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-22
Family SH3-domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027443   Gene: ENSCAFG00000018590   Transcript: ENSCAFT00000029523
Sequence length 845
Comment pep:known chromosome:CanFam3.1:20:53482498:53531224:-1 gene:ENSCAFG00000018590 transcript:ENSCAFT00000029523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNKGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRT
EPMPMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDIEIIFINI
EDLLRVHTHFLKEMKEALAAPTAPTLYQVFIKYKERFLVYGRYCSQVESASKHLDRVATA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDAVEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGERENKKWTHMFLLIEDQGVQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRAPAHKECLGRVPPCGRHGQDFSGTMKKDKPHRRAQDKKRNELGLPKMEVC
QEYYGLPPPPGAFGPFLRLNPGDIVELTKAEAEQNWWEGRNTATNEVGWFPCNRVKPYVH
GPPQDLSVHLWYAGPMERSGAESILTNRSDGTFLVRQRVKDTAEFAISIKYNVEVKHIKI
MTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRAISKPPAGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPSNYVEED
YSEYC
Download sequence
Identical sequences E2RGT8
9615.ENSCAFP00000027443 XP_542134.2.84170 ENSCAFP00000027443 ENSCAFP00000027443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]