SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029060 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029060
Domain Number 1 Region: 5-188
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-50
Family Calponin-homology domain, CH-domain 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029060   Gene: ENSCAFG00000019644   Transcript: ENSCAFT00000031229
Sequence length 309
Comment pep:known chromosome:CanFam3.1:20:57685657:57691542:-1 gene:ENSCAFG00000019644 transcript:ENSCAFT00000031229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRSWIEGLTGLSIGPDFQKGLKDGVIL
CTLMNKLQPGSVPKINRSLQNWHQLENLSTFIKAMVSYGMNPVDLFEANDLFESGNMTQV
QVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGHCVIGLQMGTNKCASQSG
MTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKC
DNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGPVADGAAGAAGGGPDPGEAPECT
PYPQEEADY
Download sequence
Identical sequences E2R5Q1
ENSCAFP00000029060 ENSCAFP00000029060 9615.ENSCAFP00000029060 XP_854646.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]