SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029192 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029192
Domain Number 1 Region: 1442-1581
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.18e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000218
Further Details:      
 
Domain Number 2 Region: 231-334
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000111
Family Calponin-homology domain, CH-domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029192   Gene: ENSCAFG00000019723   Transcript: ENSCAFT00000031364
Sequence length 1586
Comment pep:known chromosome:CanFam3.1:9:49458639:49521332:1 gene:ENSCAFG00000019723 transcript:ENSCAFT00000031364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAPDGAVDIVPLDRYDSARAKIAANLQWICAKAYGIDNIPEDLRDPFYIDQYEQEHIK
PPVIKLLLSSELYCRVCSLILKGDQVAALQGHQSVIQALSRKGIYVMESDDTPVTDPDLS
HAPIKMSAHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKELPYDLEDAMVFWVNK
VNLKMREITEKEVKLKQQLLESPAHQKSPSKWYWKLVPVRYRREHLSTRQPPYFPLLEDL
MRDGSDGAALLAVVHYYCPEHMKLDDICLKEVTSMADSLYNIRLLREFSNEYLNKCFYLT
LEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPRDVQEPKDAKTVSHHKSSRPPIPI
SNATKRSFLGSPAVASPADPQPPTQPPAEGGPRQRLRPEEPEHLGKGASAFSPSHPLLPL
RQRQQKAVQGEGPPDQRHRSNSLTRVDGQPRGAAVAWPEKKNRPVSQPAPFALHHAASCD
MDPGSGDSVSLARSISKDSLASNVINLTPQNQPQPTTLKADGQSLLNNVDIEDEDEELVA
IIRTDVAPHGGERGLPTSARSPHRLADTLESKPDSFFLEPLMPAVLRPAKEKQAIAKEEE
CGEGRPRSFTSKRPSEGHQPLVRKRAPSSHGSRDLSRTFTPIPCPELPVGMDPVPTETGP
QAAGDGRGGLLATGGFDLLPQGQSTDGFFLHVARADEDGEGRFCVGCARSPGAHDLEPWP
VLRQDSDSDVADLDEAEQDLIGEDHPVLMGRYIGEEESAKLQEDMKVKEHEDKDDASGRS
SPCLSTVSQVSSVSMASGSVRMTSFAERKLQRLNSCETKSSTSSSQKTTPDASESCPAPL
TTWKQRREQSPNRQSREHASLLASELVQLHMQLEEKRRAIEAQKKKMEALSARQRLKLGK
AAFLHVVKKGKADSAPQPRKPDHLTGDYAQHNGEDFDGGVSRTEEFLLKEEGREGVLPSP
DVDTESLVLLQHKVKAPATLHELEKTKVLSAALLEDAGEAVDVSECDLSIEKLNETISTL
QQAILRISQQQEQLLMKPPAAPAPGTKPNTQDQKVRTAIHFVEPLSPPGTTGHRKPPRLG
QGQGRNSRSGRPAELKVPRDRQQASSRSKTPTPSIETLPHLRSFPPRTPSDPGWDSVAEP
GNDPHEKCFFDSYRLHDESNQRTFVSPSSKDANILSEQMSLKEVLDSSVKEAGLSSPAVS
GKENIPADEPPRGKASLIEVDLSDLKAPDEDGETEGPQSSVDLTSEGDQKPGVGFFFKDE
QKAEDELAKKRAAFLLKQQRKAEEARVRKQQLEAEVELKRDEARRKAEEDRIRKEEEKAR
RELIKQEYLRRKQQQILEEQGLGKPKGKPKKPRPKSVHREESCSDSGTKCSSTSDHLSRA
QSGSSLSLASAATTEPESVHSGGTPSQRVESLEALPTLSRNPSRSTDRDWETASAASSLA
SVAEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKCDANHYIILF
RDAGCQFRALYCYYPDTEEIYKLTGTGPKSITKKMIDKLYKYSSDRKQFNLIPAKTMSVS
VDALTIHNHLWQPKRPAVPKKTQTRK
Download sequence
Identical sequences F1PA39
ENSCAFP00000029192 ENSCAFP00000029192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]