SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029565 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029565
Domain Number 1 Region: 100-304
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-51
Family DBL homology domain (DH-domain) 0.000000305
Further Details:      
 
Domain Number 2 Region: 291-453
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-32
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 3 Region: 580-681,730-756
Classification Level Classification E-value
Superfamily SH2 domain 2.39e-27
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 4 Region: 501-611
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000204
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 5 Region: 4-138
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000128
Family Calponin-homology domain, CH-domain 0.039
Further Details:      
 
Domain Number 6 Region: 697-745
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000205
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029565   Gene: ENSCAFG00000019951   Transcript: ENSCAFT00000031754
Sequence length 760
Comment pep:novel chromosome:CanFam3.1:6:43729781:44000437:1 gene:ENSCAFG00000019951 transcript:ENSCAFT00000031754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKSELFEAFDLFDVRDFGKVIETLSRLSRTPIALATGIRPFPTEESVSDEDIYKGLPDL
IDETHVDDEEGLYDCVYGEDEGGEVYEDLMKAEEAHQPKCPENDIRSCCLAEIKQTEEKY
TETLESIEKYFMAPLKRFLTAAEFDSVFINIPELVKVHRNLMQEIHDSIVNKNDQNLYQV
FINYKERLVIYGQYCSGVESAISSLDNISKTKEDVKLKLEECSKRANNGKFTLRDLLVVP
MQRVLKYHLLLQELVKHTTDPMEKANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQLS
IENLNQPVLLFGRPQGDGEIRITTLDKHTKQERHIFLFDLAVIVCKRKGDNYEMKEIIDL
QQYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLKKKWLEQFEMALSNIRPD
YADSNFHEFKMHTFNRVTSCKVCQMLLRGTFYQGYLCFKCGARAHKECLGRVDNCGRVNS
AEQGTLKPPEKRTNGLRRNPRQVDPGLPKMQVIKNYTGAPPPGLHEGPALHIQAGDTVEL
LRGDAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELI
NRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYK
HHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMREL
SLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE
Download sequence
Identical sequences F1PET4
ENSCAFP00000029565 ENSCAFP00000029565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]