SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000030423 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000030423
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.62e-41
Family Calponin-homology domain, CH-domain 0.000000395
Further Details:      
 
Domain Number 2 Region: 193-253
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.22e-20
Family EB1 dimerisation domain-like 0.0000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000030423   Gene: ENSCAFG00000017212   Transcript: ENSCAFT00000027258
Sequence length 263
Comment pep:novel chromosome:CanFam3.1:4:47955340:47956229:1 gene:ENSCAFG00000017212 transcript:ENSCAFT00000027258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNIYSMSVTSDNLSQHDMLTWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKK
AKLEHEYIQNFKILQAGFKRTGVDKIIPVDKLVKGNFQDNFEFVQWKKFFDAHYDGKDYD
PVFARPYSCQVKKLQWLPSLVAPALNKLKKPPSSSSAVVSRPIVTHRTITTPKAGLGVVQ
KNPDVGNGDDEAAELMQQVNVLKLTVKDLEKERDFYFGKLRNIELICQENKGENNPVLQR
IVDILYATDEGFVIPDEGGPQKE
Download sequence
Identical sequences E2R3A7
ENSCAFP00000030423 ENSCAFP00000030423 9615.ENSCAFP00000030423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]