SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000031289 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000031289
Domain Number 1 Region: 35-136
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.5e-40
Family Calponin-homology domain, CH-domain 0.0000012
Further Details:      
 
Domain Number 2 Region: 200-260
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.96e-20
Family EB1 dimerisation domain-like 0.0000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000031289   Gene: ENSCAFG00000017472   Transcript: ENSCAFT00000027689
Sequence length 273
Comment pep:novel chromosome:CanFam3.1:X:69772055:69772918:1 gene:ENSCAFG00000017472 transcript:ENSCAFT00000027689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRQDRIEARHRQWTRSCREPKMAVNVYSMSVTSDNLNLTKIEQLCSGAAYCQFMDMFFPG
SIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQENFEFVQWFKKF
FDANYDGKDYDPVGARQGQVTAVAPSLVAPALNKPKKPLSSSSAAPQRPIATYRTTATPK
AGPSVVRKNPGVCNGDDEAAELMQQVNVLKFTVEDLEKERNFYFGKLRNIELICQKNEGE
NNPVLQRIVDILYATDEGFVIPDEGGPQEEQEE
Download sequence
Identical sequences E2QW87
ENSCAFP00000031289 ENSCAFP00000031289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]