SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000031764 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000031764
Domain Number 1 Region: 121-623
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.77e-162
Family Calponin-homology domain, CH-domain 0.00000000211
Further Details:      
 
Domain Number 2 Region: 5-142
Classification Level Classification E-value
Superfamily EF-hand 4.75e-17
Family Calmodulin-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000031764   Gene: ENSCAFG00000018250   Transcript: ENSCAFT00000036393
Sequence length 630
Comment pep:known chromosome:CanFam3.1:X:88354618:88399679:1 gene:ENSCAFG00000018250 transcript:ENSCAFT00000036393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKL
MLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHS
YSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDE
RAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLF
ADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSK
AYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVS
GNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLY
ADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVG
IGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVSWVNRTLAEAGKSTS
IQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARV
YALPEDLVEVKPKMVMTVFACLMGRGMKRV
Download sequence
Identical sequences F6V234
XP_538147.2.84170 ENSCAFP00000031764 ENSCAFP00000031764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]