SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000035137 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000035137
Domain Number 1 Region: 118-620
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.33e-161
Family Calponin-homology domain, CH-domain 0.00000000264
Further Details:      
 
Domain Number 2 Region: 4-92
Classification Level Classification E-value
Superfamily EF-hand 4.42e-18
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000035137   Gene: ENSCAFG00000004491   Transcript: ENSCAFT00000039304
Sequence length 627
Comment pep:novel chromosome:CanFam3.1:22:5007837:5059465:1 gene:ENSCAFG00000004491 transcript:ENSCAFT00000039304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGSVSDEEMMELREAFAKVDTDGNGYISCNELNDLFKAACLPLPGYRVREIAENLMAT
GDLDQDGRISFDEFIKVFHGLKSTEVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSE
EEKYAFVNWINKALENDPDCRHVIPMNPNTNDLFSAVGDGIVLCKMINLSVPDTIDERTI
NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADI
ELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCNKINNFSTDIKDSKAYY
HLLEQVAPKGDEEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGNP
KLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDL
ADALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGG
QDLNEGNRTLTLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLKEAEKSSSISS
FKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDEEKLNNAKYAISMARKIGARVYAL
PEDLVEVNPKMVMTVFACLMGKGMKRV
Download sequence
Identical sequences E2QWN7
ENSCAFP00000035137 ENSCAFP00000035137 XP_005633941.1.84170 XP_005633942.1.84170 XP_013961838.1.84170 XP_013961839.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]