SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037852 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037852
Domain Number 1 Region: 103-280
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.71e-44
Family G proteins 0.0000000295
Further Details:      
 
Domain Number 2 Region: 4-107
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 6.54e-29
Family Transducin (alpha subunit), insertion domain 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037852   Gene: ENSCAFG00000029596   Transcript: ENSCAFT00000046869
Sequence length 283
Comment pep:known chromosome:CanFam3.1:6:14375081:14476642:1 gene:ENSCAFG00000029596 transcript:ENSCAFT00000046869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYFEGSRVLVDARDKLGIPWQYSENEKHGMFLLAFENKAGLPVEPATFQLYVPALSALW
RDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVI
KKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFE
TIVNNKLFFNVSIILFLNKMDLLVEKVKTVSIKKHFPDFKGDPHRLEDVQRYLVQCFDRK
RRNRSKPLFHHFTTAIDTENIRFVFHAVKDTILQENLKDIMLQ
Download sequence
Identical sequences J9NX40
ENSCAFP00000037852 ENSCAFP00000037852 XP_005621208.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]