SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038555 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038555
Domain Number 1 Region: 6-187
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.58e-40
Family Calponin-homology domain, CH-domain 0.0000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038555   Gene: ENSCAFG00000005953   Transcript: ENSCAFT00000009607
Sequence length 298
Comment pep:novel chromosome:CanFam3.1:25:389162:390071:1 gene:ENSCAFG00000005953 transcript:ENSCAFT00000009607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSSMQFNKGPWYRLSAEVKNRLLSKYDPQKEAELRSWIEGLMGLSIRPDFQKGLKDGVFL
CTLMSKLQPGSVLKINRSLQNWHQLENLSTFIKAMVSYGMNPVDLFEANDLFESGNMTQV
QVSLLTLAGKAKTQGLQSGVDIGVKYSEKQEQLQRRHHEAGQCVVGLQIGTNKCASQSGM
TAYGTRRHLYDPKNHILPPRYPLTISLQMGTKQCASQVGFPGPGGTSRTPSTKCDNSSMS
LQMGYTGANQSGQVFGLGRQIYDPKYCPQGRGADGAAGAAGAGEAPERTPYPQEKADY
Download sequence
Identical sequences J9NZ35
ENSCAFP00000038555 ENSCAFP00000038555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]