SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038823 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038823
Domain Number 1 Region: 3449-3687
Classification Level Classification E-value
Superfamily Plakin repeat 1.18e-87
Family Plakin repeat 0.0000000463
Further Details:      
 
Domain Number 2 Region: 4028-4266
Classification Level Classification E-value
Superfamily Plakin repeat 3.23e-87
Family Plakin repeat 0.0000000225
Further Details:      
 
Domain Number 3 Region: 2790-3030
Classification Level Classification E-value
Superfamily Plakin repeat 1.22e-86
Family Plakin repeat 0.0000000848
Further Details:      
 
Domain Number 4 Region: 178-406
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-86
Family Calponin-homology domain, CH-domain 0.000000574
Further Details:      
 
Domain Number 5 Region: 3118-3357
Classification Level Classification E-value
Superfamily Plakin repeat 2.35e-79
Family Plakin repeat 0.000000358
Further Details:      
 
Domain Number 6 Region: 3786-4023
Classification Level Classification E-value
Superfamily Plakin repeat 8.63e-76
Family Plakin repeat 0.000000914
Further Details:      
 
Domain Number 7 Region: 4339-4380,4415-4609
Classification Level Classification E-value
Superfamily Plakin repeat 5.41e-70
Family Plakin repeat 0.00000029
Further Details:      
 
Domain Number 8 Region: 422-538
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-22
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 9 Region: 762-864
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-18
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 10 Region: 1296-1481
Classification Level Classification E-value
Superfamily Spectrin repeat 1.95e-18
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 11 Region: 668-760
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000301
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 12 Region: 4286-4344
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000759
Family Plakin repeat 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000038823
Domain Number - Region: 869-948
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000122
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 1186-1295
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000525
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038823   Gene: ENSCAFG00000001433   Transcript: ENSCAFT00000047267
Sequence length 4691
Comment pep:known chromosome:CanFam3.1:13:37442695:37502589:-1 gene:ENSCAFG00000001433 transcript:ENSCAFT00000047267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGMLMPRDQLRAVYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASLRARGL
VRETFAWRHFYWYLTNEGIAHLRQYLHLPPEIVPASLQRVRRPVAMVMPARRIPHVQSVQ
GPLSCPPKWGPVPTEDPAHEERRVYRRKEPEEGASEPPVVPATTPGNLARPGPKPAPATD
ERDRVQKKTFTKWVNKHLIKHWRAEAQRHISDLYEDLRDGHNLISLLEVLSGDSLPREKG
RMRFHKLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVSG
QSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTSSWRDGRLFNAIIHRHRPMLIDMSKVYRQ
TNLENLDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAMPRVPDVQDGVK
ANELQLRWQEYRELVVLLLQWMRHHTAAFEEHRFPSSFEEIEILWCQFLKFKETELPAKE
ADKNRSKGIYQSLEGAVQAGQLKVPPGYHPLDVEKEWGKLHVAILDREKQLRSEFERLEC
LQRIVSKLQMEAGLCEEQLNHADALLQSDVRLLAASKAPQRAAEVERDLDKADGMIRLLF
NDVQTLKDGRHPQGEQMYRRVYRLHERLVAIRTEYNLRLKSGVAAPVTQVTMQTTQRRPE
LEDATLRYLQDLLAWVEENQRRVDSAEWGGDLPSVEAQLGSHRGLHQSIDEFRAKIERAR
ADEGQLSPAPRGTYRDCLGRLDLQYAKLLNSSKARLRSLESLHGFVAAATKELMWLSEKE
EEEVGFDWGEHNSNMAAKKESYSALMRELEVKEKKIKEIQSTGDRLLREGHPARPTVESF
QAALQTQWSWMLQLCCCIEAHLKENTAYFQFFSDVRETEEQLRKLQEMLRRKYICDRSIT
VTRLEDLLQDAQDEKEQLNEYRAHLSGLAKRAKAVVQLKPRDQAQPVRGLVPLQAVCDYK
QVEVTVHKGDQYQLLGPAQPAHWKVLSSSGSEAAVPSVCFLVPPPNQEAQEAVSRLEAQH
QALVALWHQLHVDMKSLLAWQCLSRDVQLIRSWSLVTFRTLKPEEQRQALRSLELHYQAF
LRDSQDAGGFGPEDRLQAEREYGSCSRHYQQLLQSAEQGAQEESRCQRCISELKDIRLQL
EACETRTVHRLRLPLDKEPARECAQRIAEQQKAQAEVEGLGKGVARLSAEAEKVLALPEP
SPAAPTLRSELELTLGKLEQVRSLSAIYLEKLKTISLVIRSTQGAEEVLRAHEEQLKEAQ
AVPATLPDLEATKAALKKLRVQAEAQQPVFDALRDELRGAQEVGERLQRQHGERDVEVER
WRERVAPLLERWQAALAQTDVRQRELEQLGRQLRYYRESADPLGTWLQDAKQRQERIQAV
PLANSQAVREQLQQEKELLEEIERYGEKVDECQQLAKQYINAIKDYELQLVTYKAQLEPV
ASPAKKPKVQSGSESVIQEYVDLRTRYSELTTLTSQYIKFIRETLRRMEEEERLAEQQRA
EERERLAEVEAALEKQRQLAEAHAQAKAQAEREAEELQRRMQEEVARREEAAVDAQQQKR
SIQEELQHLRQSSEAEIQAKARQVEAAERSRVRIEEEIRVVRLQLEATERQRGGAEGELQ
ALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAEAEAAREKQRALQ
ALEDVRLQAEEAERRLRQAEADRARQVQVALETAQRSAEVELQSKRASFAEKTAQLERTL
QEEHVAVAQLREEAERRAQQQAEAERAREEAEQELERWRLKANEALRLRLQAEEVAQQKS
LAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLVAEQELI
RLRAETEQGEQQRQLLEEELARLQREAAAATHKRQELEAELAKVRAEMEVLLASKARAEE
ESRSTSEKSKQRLEAEASRFRELAEEAARLRALAEETKRQRQLAEEDAARQRAEAERVLA
EKLAAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAAQHKADIEERLA
QLRKASENELERQKGLVEDTLRQRRQVEEEILALKASFEKAAAGKAELELELGRIRSNAE
DTLRSKEQAELEATRQRQLAAEEEQRRREAEERVQKSLAAEEEAARQRKSALEEVERLKA
KVEEARRLRERAEQESARQLQLAQEAAQKRLQAEEKAHAFAVQQKEQELQQTLQQEQSML
ERLRAEAEAARRAAEEAEEARERAEREAAQSRRQVEEAERLKQLAEEQAQAQAQAQAAAE
KLRKEAEQEAVRRAQAEQAALKQKQVADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLE
ETDHQKSILDEELQRLKAEVTEAARQRNQVEEELFSVRVQMEELSKLKARIEAENRALIL
RDKDNTQRFLQEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKM
QAVQEATRLKAEAELLQQQKELAQEQARQLQEDKEQMAQQLAQETQGFQRTLEAERQRQL
EMSAEAERLKLRVAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVHTLEI
QRQQSDHDAERLRAAITELEREKEKLQEEATLLQQKSEEMQVVQQEQLLQETRALQESFL
SEKDRLLQRERFIEQEKAKLEQLFRDEVAKAQKLREEQQRQQQQMEQEREQLVASMEEAR
QCQREAEEGVRRKQEELQLLEQQRQQQERLLAEENQRLRERLQRLEEEHRAALAHSEEIA
ASQAAAAKALPNGRDAPDGPAVEAEPEHMFDGLRRKVPAQRLQEVGILSAEELQRLAQGR
TTVAELAQREDVCQYLQGRGGIAGLLLKPANEKLSIYAALRRQLLSPGTALILLEAQAAT
GFLLDPVQNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTGEQISLFQAMQKEL
IVRDHGIRLLEAQIATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDP
NTHENLTYLQLLERCVLDPETGLRLLPLTDQAARGGELVYTDSEARDVFEKATVSAPFGK
FQGRTVTIWELINSEYFTTEQRRDLLRQFRMGKVTVEKIIKIVITVVEEHEQKGQLCFEG
LRALVPAAELLESGVIDHNLYRQLQRGERSVREVAEVDAVRRALRGTSVIAGVWLEETGQ
RLSIYEALKKDLLPPEVAVALLEAQAGTGHIIDPATSARLTVDEAVRAGLVGPELHEKLL
SAEKAVTGYKDPYSGQSVSLFQALKKGLIPREQGLRLLDAQLSTGGIVDPSKSHRVPMDV
AYARGYLDQETSRALSAPQDEAKTYHDPSTQEPVTYGQLQQQCRPDPLTGLSLLPLSEQA
AQARREGLYSELQARETFQKTPVEVPVGSFKGRTVTVWELLSSEYFTTEQRQELLRQFRT
GTVTVEKIIKIVITIVEEVETVRQERLSFSGLRAPVPASELLASGVLSRTQFEQLKDGKT
SVKDLSELSSVRTLLQGSGCLAGIYLEESKEKVTIYEAMRRGLLRPSTATLLLEAQAATG
FLIDPVRNQRLYVHEAVKAGVVGPELHEKLLSAEKAVTGYKDPYSGSTISLFQAMKKGLV
LREHGIRLLEAQIATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPN
THENLTYLQLLERCVEDPETGLRLLPLKGAEKTEVVESTQVYTEEETRRAFEETQIDIPG
SAGRSGSTMSLWEVMQSDLIPEEQRTRLMADFQAGRVTKERMIIIIIEIIEKTEIVRQQN
LASYDYVRRRLTAEDLYEARIISRETYSFLREGTKSLRQVLEEEEASRYLYGTGCVAGVY
LPGSRQTLTIYQALKKGLLNAEVARFLLEAQAATGFLLEPVKGERLTVDEAVRKGLVGPE
LHDRLLSAERAVTGYRDPYTEQTISLFQAMKKDLIPTDEALRLLDAQLATGGIVDPHLGF
HLPLEVAYQRGYLNKDTHDQLSEPSEVRSYLDPSTDERLSYTQLLRRCRRHETSGQMLLP
LSDARKLTFRGLRKQITVEELVRSQVLDEATALQLQEGLTSVEEVTKNLQKFLEGTSCIA
GVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTVEEAVRMGIV
GPEFKDKLLSAERAVIGYKDPYSGKLISLFQAMKKGLILKDHGIRLLEAQIATGGIIDPE
ESHRLPVEVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGL
CLLPLKEKKRERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQEC
EWEEITISSSDGVVKSMIIDRRSGRQYDIDEAIARNLIDRSALDQYRAGTLSITEFADML
SGNAGGFRSRSSSVGSSSSYPISPATSRTQAASWSDPTEETGPVAGILDTETLEKVSITE
AMRRNLVDNITGQRLLEAQACTGGIIDPSSGERFPVTDAVSRGLVDKIMVDRINLAQKAF
CGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEAQYLTGGLIEPDVPGRVPLDEALQRGM
VDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSSKGYYS
PYSVSGSGSAAGSRSGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSSGYGRRYASGPV
SSLGGPESAAA
Download sequence
Identical sequences F1PHS5
ENSCAFP00000002076 ENSCAFP00000038823 XP_005628109.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]