SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039939 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039939
Domain Number 1 Region: 15-212
Classification Level Classification E-value
Superfamily L domain-like 5.27e-40
Family Ngr ectodomain-like 0.071
Further Details:      
 
Domain Number 2 Region: 573-682
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.27e-24
Family Calponin-homology domain, CH-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039939   Gene: ENSCAFG00000014336   Transcript: ENSCAFT00000048226
Sequence length 686
Comment pep:novel chromosome:CanFam3.1:6:9102516:9113368:1 gene:ENSCAFG00000014336 transcript:ENSCAFT00000048226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSAERALEEAVATGTLNLSNRRLKHFPRGAARSYDLSDITQADLSRNRFPEVPEAACQLV
SLEGLSLYHNCLRCLNPALGNLTALTYLNLSRNQLSSLPPYICQLPLRVLIVSNNKLGAL
PPDISALGSLRQLDVSGNELQALPAELCSLPSLRDLSVRRNQLSTLPDELGDLPLVRLDF
SCNRVSRIPVSFCRLRHLQVILLDSNPLQSPPAQICLKGKLHIFKYLSTEAGRRGGSALG
DLASSRPPSFSPCTSPAEDLFPGRRYDGGLDSGFHSVDSGSKRWSGNESTDEFSELSFRI
SELAREPRGPKERRHALASPADGDPEQIDFIDSHMPGEEEERGAAEVRVQPLASCPVCAL
CGREESGGREGGSGAGLEEETLPQPSAALSLGASATRIEPCHRGCREGTKQQVPQSHLSQ
HLLPLPHPPGRLLLSPDLCLSPSLVLPLTLRREEPAGEERRRPDTLQLWQERERRQQQQQ
QQQQHTGVWGASRKDSGMPKSSATQPGPSGGQGAPAPTSASQEPLPAAGPGGTGTLRPNS
FLFRSSSQSSSGPSSPDPVLKPRRSPQLLDEKEVMAQLRQVLESRLQRPLPEDLAEALAN
GVILCQLANQLRPRSVPFIHVPSPAVPKLSTLKSRKNVESFLEACRKMGVPEESLCQPHH
ILEEEGAPGRGLPYIAAVIHALLERP
Download sequence
Identical sequences F1P6K9
ENSCAFP00000021150 ENSCAFP00000039939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]