SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000040658 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000040658
Domain Number 1 Region: 23-152,186-293
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-78
Family Calponin-homology domain, CH-domain 0.0000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000040658   Gene: ENSCAFG00000017709   Transcript: ENSCAFT00000049187
Sequence length 1016
Comment pep:known chromosome:CanFam3.1:8:64088653:64168178:-1 gene:ENSCAFG00000017709 transcript:ENSCAFT00000049187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAKRLWSWAGKKWILATMQVIVDPLLFSVERENVQKRTFTRWVNLHLEKCNPPLEVKDLF
VDIQDGKILMALLEVLSGRNLLHEYKSSSHRIFRLNNIAKALKFLEDSNVKLVSIDAAEI
ADGNPSLVLGLIWNIILFFQIKELTGNLSRNSPSSSLSPGSGGTDSDSSFPPTPTAERSM
AVSVKDQRKAIRTLLAWVQRKTRKYGVAVQDFAGSWRSGMAFLAVIKAIDPSLVDMKQAL
EDSMRENLEKAFSIAHEALHIPRLLEPEDIMVDTPDEQSIVTYVAQFLEHFPELEAEDFS
DLDKEAPIESTFVRIKETPSEQESTVFLLTENGDRAYTINHEASQPPPSKVFVCDKPESM
KESFQDGVSSCALSDSAPEFMHQIIDQALQGDPGKASSTNDPSPESSILSSRKDSRRSNS
LPIKKTVHFEADTFKDASYSKDPFYSHDFRFEGSPRGTKDSLKQDGYLLAVEIAEEKSQQ
EAPKIAEAASDESPGDVSLADGKSNHSQTSQSSPSWNGEPEGAGSPGEESCPLSPLEDNT
IMANSLEFKVKLLTVEAMGGEDYFEGIPFKTSKFSSDLIDVASTSQAFNEVPSPHEKKPA
EDEVLEDHAEKPEKRRSKSVHQRKDSDESPERPDGLEPHRDTGQEDQGSSPAPGEAPVDK
KPEVYEKPKRKSPRRRRGEDNGEAPGLQEPEGELSPDPLRGSDSLETLCSRSEEGLDFKP
SPPLSKISVIPHDLFYYPHYEVPLAAVLEAYAEGVEDLKNEDLELEEPEGYPCAVGARDE
AQEAAEAEASRSSCSFSGPEEDVPEASIPAAPCPDGGVEDATLAAEPATLSPPDDRQRGE
ADDCAPVESHQAQEFGNSGTLANSLEEKVMGESISSKKKEKRKHVDHVESSVFIAPGTVR
SSDDLEEDTGDHKVLSRTSHSDSSIYVRRHTNRSLESDHFSYVQLRNAADLDDRRNRMLT
RKANNSGEATLPESQSPQSDSLTQFVQQPDLMYFILFLWLLVYCLLLFPQLDVNRL
Download sequence
Identical sequences E2RIN0
ENSCAFP00000026127 ENSCAFP00000040658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]