SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042098 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042098
Domain Number 1 Region: 1-200
Classification Level Classification E-value
Superfamily L domain-like 7.82e-35
Family Leucine rich effector protein YopM 0.053
Further Details:      
 
Domain Number 2 Region: 513-619
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.97e-25
Family Calponin-homology domain, CH-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042098   Gene: ENSCAFG00000004478   Transcript: ENSCAFT00000047511
Sequence length 662
Comment pep:novel chromosome:CanFam3.1:22:4573064:4781189:-1 gene:ENSCAFG00000004478 transcript:ENSCAFT00000047511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSKNRLVEVPMELCHFVSLEILNLYHNCIRVIPETIINLQMLTYLNLSRNQLSALPACL
CGLPLKVLIASNNKLGSLPEEIGQLKQLMELDVSCNEITALPQQIGQLKSLRELNVRRNY
LKVLPQELVDLPLVKFDFSCNKVLVIPICFREMKQLQVLLLENNPLQSPPAQICTKGKVH
IFKYLSIQACQIKTTDSLYLQTMERPHLQQHVEDSKKDSDSGVGSDNGDKRLSATEPSDE
DTVSLNVPMSNIMEEEQIIKEDSCHRLSPVKGDFNQEFQPEPSLLGDNDNSGEERDQFTD
GTDVLRSEFITYIKDRTEDCEELLRIEEDTHWQPEGIVSSSKDQDMDIAMIEQLREAVDL
LQDPNRLSADITERNVVNFYPMESAEALDLQDSALNGQIQLETSPECEVQNDLTLQSNGS
EYSPNEIRVNSPAVSPTSNSTAPFGLKPRSDPALTLPPISFNKLTQAQTWDSSSYSVPSE
GDSDNVFLRPQRNLESIDPQFTIRRKMEQMREEKELLDQLRESIEMRLKVSLHEDLGAAL
MDGVVLCHLVNHIRPRSVASIHVPSPAVPKLSMAKCRRNVENFLEACRKLGVPEADLCSP
CDVLQLDFRHIRKTVGALLALGDKAPRPSSALRSRDLLSFCLVHILFVILALVTYRWSVL
AA
Download sequence
Identical sequences F1PP83
ENSCAFP00000042098 ENSCAFP00000006677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]