SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042257 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042257
Domain Number 1 Region: 231-430
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-48
Family DBL homology domain (DH-domain) 0.0000000819
Further Details:      
 
Domain Number 2 Region: 423-546
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-35
Family Pleckstrin-homology domain (PH domain) 0.00000221
Further Details:      
 
Domain Number 3 Region: 1-119
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-26
Family Calponin-homology domain, CH-domain 0.00069
Further Details:      
 
Domain Number 4 Region: 161-231
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-24
Family SH3-domain 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042257   Gene: ENSCAFG00000018952   Transcript: ENSCAFT00000047224
Sequence length 775
Comment pep:known chromosome:CanFam3.1:X:107029681:107100021:-1 gene:ENSCAFG00000018952 transcript:ENSCAFT00000047224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPEERIVTWLISLGVLDSPKKTICDPEEFLKSSLKNGVVLCKLINRLRPGSLEKYCLEP
QTEADCLNNISDFLKGCAALQVEVFDPDDLYSGANFSKVLSTLLAVNKATEDQLSERPCG
RSSLTAANSSQTNPQGGVASTAPGLQRQSKTVEMTENGSHQLIVKARFNFKQTNEDELSV
CKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAVKGFETTPLTKNY
YTVVLQNILDTEKDYAKELQSLLVTYLRPLQSNNNLSTVEFTSLLGNFEEVCSFQQTLCQ
ALEECSKFPENQHKVGGCLLNLMPHFKSMYLAYCANHPSAVNVLTQHSDDLEQFMESQGA
SSPGILILTTSLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIIAFKTLMGQCQDL
RKRKQLELQILSEPIQAWEGENIKTLGNVLFMSQVMMQYGTSEEKEERYLMLFSSVLILL
SASPRMSGFIYQGKIPVAGMVVTRLDEIEGNDNTFEITGNMVDRIVIHCNNSQDFQEWLE
QLYRLIRGPASCSSLSKTSSSSCSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLR
PSAALGYKERMSYILKESSKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEEDAQILK
VIEAYCTSANFQQGHGSSARKDSLPQVLLPEEEKLIIEETRSNGQTIIEEKSLVDTVYAL
KDEVKELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECIRAESSSKTSILP
Download sequence
Identical sequences E2R0Z1
XP_852793.3.84170 ENSCAFP00000027983 ENSCAFP00000042257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]