SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000744 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000744
Domain Number 1 Region: 7-102,133-241
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.32e-65
Family Calponin-homology domain, CH-domain 0.000083
Further Details:      
 
Domain Number 2 Region: 8022-8177
Classification Level Classification E-value
Superfamily Spectrin repeat 2.99e-21
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 8401-8515
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-19
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 7802-7926
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-18
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 3299-3421
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-18
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 6 Region: 1589-1723
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-18
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 7 Region: 7394-7525
Classification Level Classification E-value
Superfamily Spectrin repeat 7.44e-17
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 8 Region: 6939-7083
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-16
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 9 Region: 4475-4630
Classification Level Classification E-value
Superfamily Spectrin repeat 4.48e-16
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 10 Region: 3855-3995
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-16
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 11 Region: 7064-7195
Classification Level Classification E-value
Superfamily Spectrin repeat 9.68e-16
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 12 Region: 5028-5171
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000216
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 13 Region: 2425-2554
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000025
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 14 Region: 4255-4411
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000798
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 15 Region: 6728-6868
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000118
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 16 Region: 1369-1504
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000276
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 17 Region: 3727-3848
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000309
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 18 Region: 3083-3207
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000555
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 19 Region: 522-662
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000187
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 20 Region: 2643-2769
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000864
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 21 Region: 7592-7743
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000936
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 22 Region: 7315-7428
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000017
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 23 Region: 3533-3665
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000173
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number 24 Region: 7930-8040
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000448
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 25 Region: 8478-8624
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000141
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 26 Region: 2211-2366
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000151
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 27 Region: 5896-6034
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000394
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 28 Region: 2800-2914
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000399
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 5698-5775,5886-5932
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000442
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 30 Region: 1040-1191
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000018
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 31 Region: 4924-5022
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000202
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 32 Region: 1678-1829
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000662
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 33 Region: 1481-1585
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000993
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 34 Region: 5135-5274
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000226
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 35 Region: 2999-3109
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000256
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 36 Region: 1888-2040
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000648
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 37 Region: 5440-5559
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000648
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 38 Region: 3448-3559
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000157
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 39 Region: 2015-2153
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000204
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 40 Region: 5561-5654
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000824
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 41 Region: 6522-6606
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000226
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 42 Region: 6346-6451
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000419
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 43 Region: 4172-4300
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000694
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 44 Region: 4843-4953
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000144
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 45 Region: 852-978
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000144
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 46 Region: 3210-3307
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000245
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 47 Region: 3967-4099
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000288
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 48 Region: 6044-6159
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000849
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 49 Region: 6618-6722
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000849
Family Spectrin repeat 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000000744
Domain Number - Region: 4617-4738
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000288
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 5243-5381
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0141
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number - Region: 4084-4188
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0366
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000744   Gene: ENSCAFG00000000445   Transcript: ENSCAFT00000000809
Sequence length 8764
Comment pep:novel chromosome:CanFam3.1:1:42667180:42831889:-1 gene:ENSCAFG00000000445 transcript:ENSCAFT00000000809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAKRKPPLVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLE
GRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSGSTSSVDSMVS
AETASPPSKRKVATKIQGNAKKALLKWVQYTVAKLRQTGTEVKDFGRSWRSGVAFHSVIH
AIRPELVDLEKVKGRSNRENLEEAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQF
LKHYPDIHNTGTDGQENDEILPGFPSFANSIQNFKREDRLILKETKVWIEQFERDLTRAQ
MTESNLQDKYQSFKHFRVQYEIKRKQIEHLIQPVHRDGKLSLDQALVKQSWDRVSSRLFD
WHIQLDKSLPAPLGTIGAWLYRAEVALREEITIQQVHEETANTIQRKREQHKDLLQNTDA
HKRAFHEIYRTRSVNGIPVPPDQLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVL
AESKLKSWIIKYGRRESVELLLQNYISFIENTKFFEQYEVTYQILKQTAEMYIQADGSVE
EAENVMKFMNETTAQWRNLSVEVRSVRSMLEEVIANWDRYGNTVASLQAWLEDAEKMLNQ
TEHAKKDFFRNLPHWIQQHAAMNDAGNFLIETCDEMVSRDLKQQLLLLNGRWRELFMEVK
QYARADELDRMKKEYTDCVNALSDFAMGAHKKLSEPLEVSFLNVKLLIQDLEDIEQRVPV
MDAQYKMITKTAHLITKESSQEEANEMFATMSGLKEQLTKVKDCYSPLLYESQQLLIPLE
ELEKQMTFFYDSVGKINEILTVLEHEAQSSAVFKQKQQELSACQESCKKTMTQIEKGSQN
VQKFMTLSSVLKHFDQTKLHRQIADAHGAFQNMMKKIGDWKKHVETNSRLMKKFEESRAE
LEKVLRIAQEGLEEKGNPEDLLRRHTEFFSQLDQRVLNAFLKACDELTDILPEQEQQGLQ
EAVRKLHKQWKDLQGEAPYHLLHLKIDVEKNRFLASVEECRTELDRETKLVPQEGSEKII
KEHRIFFSDKGPHHVCEKRLQLIEELCLKLPGRDPVRNTPETCHVTLKELRAAIDTTYMK
LVEDPDKWKDYTSRISQFSSWISAKETELKGFKNEPIDTANHGKVKHAVEEIRNDVTTKG
ETLNWLKSRLKVLIEVSSENEAQKQGDELAKLSGSFKALVALLSEVEKMLSNFGDCVQYK
EIVKSSLEELISGSKEIQEQAEKILDTENLFEAQQLLLHHQQKTKRISAKKRDVQQQIEQ
AQQGEGGLPGQVREELRKLESTLDNMEHSREKQERRIQVTLRKWERFETNKETVVRYLFQ
TGSSHERFLSYSSLESLSSELEQTKEFSKRTEGIAVQAENLVKEASEIPLGPKNKQLLQQ
QAKSIKEQVKKLEDTLEEDIKTMEMVKNKWDHFGNNFETLSIWITEKEKELNALETSSSA
MDMQIHQIKVIIQEIQSKLSSITELEESAQSFAQFVTTGESARIKAKLTQIRRYWEELRE
HAQCLEGTILGHLSQQQKFEENLRKIQKSVSEFEDKLADPVKICSSATETYKVLQEHMDL
CQALEALSSTVATTSASAQKVANRGSCVQEAAALQQRYQEMQSQAKEKQTALEKLLAHWQ
RLEKELSTFLTWLERCEAITSSPEMDISSDRVKVESELQSIQALQNEVVSQASVYSNLLQ
LKESLFSVASKDDVKMMKLHLEQLDERWRDLPQIISKRIAFLQSVVAEHQQFDELLLSLS
VWIKLFLSELQSTSEISITDHQAAFTRHKDHAAEVESKKGELQSLQDHLVKLGALVRAES
LPLLQGKAEDCFQLFEEASQVVERRQLALAQLAEFLQSHVSLSGVLHRLRHTVEATNSMN
RKQTDLLEKDLNHAIQDAKSLESVAISLDSVLAKAQYHLKSGSSEQRTSCRTTADHLCSE
LERIQNLLGIKQSEADALAVLKKAFQDQKEELLKSIEDIEERTDKERLKELTRQALQQRL
RVFNQLEDELNSHEHELCWLKDKAKQIAQKDVAFASEVDREVNRLEVTWDDTKKLIHENQ
GQCCGLIDLIREYQNLKSAVSKVLENASNVIATRTTIKDQEDLKWALSKHETAKNEMCNE
QKELDFTSKGKQLLFELKKIHSSDFILVKTDMDSTVDRWLDISEKIEENMDRLRVSLTIW
ADVLSSKDEIDGWCNSSVPRLAESISNLNNSLRAEEFLKEFESEVKNKALRLEELHCKVN
DLKELTKNPETPPDLQFVEADLRQKLEHAKEITEEAKGTLKDFTAQSTQVEKFINDITSW
LTKVEESLMNCAQTETWEGLKKVKEIQKELQSQQSNISSTQENLNSLCRKYHSVELESLG
SALTGLIKNQEAVSQLCSKTQASLQDSLVKHFNEESMQEFQEWFSGIKTAAKESSDRTGD
SKVLEAKLHNLQQNILDSISDGQSKLDAVTQEGQTLYAHVSKQIVGSIQEKITKANEEFQ
AFLKQCLKDKQTLQDCALELGSFEDQHRKLNLWIHEMDERLSTENLGESKQHIPEKKNEV
HKVEMFLGELLAARESLDKLSQRGQLLSEEGHGAGKEGRLCSQLLTNYQNLLRMTKEKLR
SCQVALQEHEALEEALQSMWSWVKAIQDRLAGAESTIGSKDTLEKRLLQIQDILLMKGEG
EVKLNMAIGKGEQALRSSNKQGQKVIQTQLQTLKDVWADIMSSSVHAQSTLESVISKWND
YLEWRNQLEQWMESVDQKIEHPLQLQPGLKEKFSLLDHFQSIVSEAEDHAGALQHLTSKS
RELYQKTENESFKETAQEELKTQFNDIITVSKEKMRKAEEIVKDHLMYLDAVQEFTDWLH
SAKEELHRWSDMSGDSSATQKKLSKIKELMDSREIGASRLSRVELLAPTVKQNTSASGCE
LVDTEMQALRADWKQWEDSVVQTQTSLENLVSQMALSEQEFSGQVAQLEQALEQFSALLT
TWAQQLALLEGKNTDKEIVECWQKGQEILDALQKAEPKTEDLKSQLNELCRFSRDLSTYS
GKVSSLIKEYNCLCLQASKGCQNREQILQQRFRRAFKDFQQWLVNAKITTAKCFDIPQNI
NEVSTNLQKIQEFLSESENGQHKLNMMLSKGELLSTLLTKEKADGIQAKVVTAKEDWKNF
HSNLHQKESALENLKIQMKDFEVSAEPVQDWLSKTEKLVQESSNRLYDLPAKRREQQKLQ
SVLEEINCYEPQLNRLREKAQQLWEGQAASKSFMHRVSQLSSQYLALSNLTKEKVSRLDR
IVAEHNQFSLGIKELQDWLTDAVHMLDSYCHPTSDKSVLDSRMLKLEALLSVKQEKEIQM
KMIVTRGESVLQNTSPEGIPAIQQQLQSVKDMWASLLSAAIRCKSQLEGALSKWTSYQDD
VRQFSGWMDSMEASLNESERQYAELREKTSALGKAKLLSEEVLSYSSLLETIELKGAGMT
EHYVTQLEFQDLQERYRTIKERAKEAVTKSEKLVRLHQEYQRDLKAFEVWLGQEQENLDR
HSVLEGDAHTHETTLRDLQELQVRCAEGQALLNSVLHTREEVIPSGIPQTEDRALESLRQ
DWQAYQQRLTETRTQFNNVVNKLRLMEQKYQQVDEWLKTLENKVKVRTGRQSNRAAKEIQ
LHQMKKWHEEVTAYKDEVEEVGARAQEMLDENHVSSRMGCQATQLTSRYQALLLQVLEQI
KFLEEEIQSLEESELSLNSYSDWYTSTHKNFKNVATKIDRVDKAMMGKKMKMLEGLLKDM
EKGHSLLKSTREKGERALKYLEDSEAETLRNEIHEHMEQLKELTSTVRKEHMTLEKGLLL
AKEFSDKYKALTQWISEYQEILHTPEEPKMELYEKKAQLSKYKSLQQMVLSHEPSVKSVR
EKGEALLELVQDVTLKDEIDKLQSDYKDLCDAGKEHVCSLETKVKDHEDYNSELQEVEKW
LLQMSGRLVAPDLMETSSLETITQQLAHHKAMMEEIAGFEDRLNNLKIKGDNLISQCADH
LQAKLKQNVHAHLQGTSDSYSAICSTAQRVYQSLEHELQKHVSRQDTLQQCQAWLSAVQP
DLKPSQLPPLSRAEAVKQVKHFRALQEQARTYLDLLCSMCDLSNSSVKTTAKDIQQTEQM
IEQRLAQAQNLTQGWGEIKHMKAELWIYLQDADQQLQNMKRRHSELELNIAQNMVSQVKD
FVKKLQCKQASVTAITERVNKLTKKQESPEHKEISHLNDQWLDLCLQSNNLCLQREEDLQ
RTRDYHDCMNVVEVFLEKFTTEWDNLARSDAESTAVHLEALKKLALALQERKQAIEDLKD
QKQKMIEHLNLDDKELVKEQTSHLEQRWFQLEDLVKRKIQVSVTNLEELNVVRSRFQELM
EWAEEQQPNISEALKQSPPPDVAQNLLMDHLAICSELEAKQMLLKSLIKDADRVMADLGL
NERQIIQKALSDAQSHVNCLSDLVGQRRKYLNKALSEKTQFLMAVFQATSQIQQHERKIM
FREHICLLPDDVSKQVKTCKSAQASLKTYQNEVTGLWAQGRELMKGATEQEKSEILGKLQ
ELQSVYDTVLQKCSHRLQELEKNLVSRKHFKEDFDKACHWLKQADIVTFPEINLMNESAE
LHTQLAKYQHILEQSPEYENLLLTLQRTGQAILPSLNEVDHSYLNEKLNALPLQFNVVVA
LAKDKFYKVQEAILARKEYASLIELTTQSLSELEDQFLKMNKVPTDLIVEEALSLQDGCR
ALLREVSGLGEAVDELNQKKESFRSTGQPWQPDKMLHLVTLYHRLKRQAEQRVNLLEDTT
SAYQEHEKMCHQLEKQLEAVKTEQSKVNEETLPAEEKLKMYHSLAGSLQDSEIILKRVTV
HLEDLVPHLDPLAYEKAKQQIQSWQEELKLLTSAIGATVTECESRMVQSIDFQTELSRSL
DWLRSVKAELSGPVCLELSLQDIQEEIRKIQIHQEEVQSSLRIMNALSNKEKEKFTKAKE
LISADLQHTLAELSELDGDIQEALRTRQAALTQIYSQCQRYYQVFQAANDWLEDAHEMLQ
LAGNGIDVESAEENLKSHMEFFSTEDQFHRNLEELQGLVASLDPLIKPTGKEDLAQKMAS
LEDKSQRIIQDSHAQLDLLQRCAAQWQDYQKAREEVIELMNDAEKKLSEFSLSKTSSSHE
AEEKLSEHKSLVSVVNSFHEKVVALEDKTSQLEKTGNDASKAAISRSMTTVWQRWTRLRA
VAQDQEKILEDAVDEWKSFNNKVKKATEIIDQLQDKLPGSSAEKASKAELLTLLDFHDTL
ILELEQQQLALGLLRQQALSMLQDGATKSPGEEPSIVQEITTMQDRCLNMQEKVKSNGKV
VKQELKEREVVETQINSVKSWVQETKEYLGNPTIEIDAQLEELQILLTEATNRRQNIEKM
TEEQKNKYLGLYSILPSEVSLQLAEVALDLGTIHDQIQDKVREVEQSKAMSQEFSRQIQK
IAKDLTTILSKLRAKTDNLAQAKSDQKVLGEELDGCNLKLMELDAAVQKFSEQNGQLGKP
LAKKIGKLTELHQQTIRQAENRLSKLSQAASHLEEYNEMLEFILKWIEKAKVLVHGKITW
NSANQLREQYVLHQTMLEESEEIHSNLEAMIVKLQYLASVYSTEKMSQQVAELGRESEEL
RQMIKIRMHNLQDAAKDMKKFETELKNLQVALEQAQTTLTSPEVGRLSLKEQLSHRQHLL
SEMESLKPKVHAVQICQSALRIPEDVVTSLPLCHAALHLQEEASRLQHTAIQQCNIMQEA
VVQYEQYEQEMQHLRELIEGAHREIEDTPVATSNIQELQAQISRHEELAQKIKGYQEQIA
SLNSKCKMLTMKAKHATMLLTVTEVEGLAEGTEDLDRELLPATSAHPSVVMMTAGRCHTL
LSPVTEESGEEGTNSEISSPPACRSPSPVANADASVNQDIAYYQALSAERLQTDAARIHP
STLPSQEFYEPGLEPSATAKLDDLQRSWETLKNVISEKQRTLYEALERQQKYQDSLQSIS
TKMEAIEMKLSESLEHGRSPESQMAEHQALMDEILMLQDEISELQSSLAEELVSESPESD
PAEQLALQSTLTVLAERMSTIKMKASGKRQLLEEKLNDQLEEQRQEQALQRYRCEADELD
HWLLSTKATLDTALGTAKEPMDMEAQLVDCQNMLLEIEQKVVALSELSVHNDNLLLEGKA
HTKEEAEQLAIKLRVLKGSLLELQRALHDKQLNIQGTAQEKEESHVDLTASQSPGVQEWL
AQARTTWTHQRQSSLQQQKQELEQELAEQKSLLRSVASRGEEILTQHSAAETSGGAGEKP
DVLSQELGMEGEKSAAEDQMRMKWESLHQEFSTKQKLLQNVLEQEQEQLLYSRPNRLLSG
VPLYKGDGQTQDKSAVTSLLDGLNQVFEEVSSQSGGKKRQNIHLEQKLYDGVSATSTWLD
DVEERLFVATALLPEETEACLFNQETLAKDIKEMSEEMDKNRNLFSQAFPENGDNRDVIE
DTLGCLLGRLSLLDSVVNQRCHQMKERLQQILNFQNDLKVLCTSLADNKYIILQKLANVF
EQPVAEQIEAIQQAEDGLKELDAGIIELKRRGDKLQIEQPSMQELSKLQDMYDELMMTIG
SRRSGLNQNLALKSQYERALQDLADLLETGQEKMAGDQKIIVSSKEEIQQLLDKHKEYFQ
GLESHMILTETLFRKIISFAVPQETQFHTELMAQASAVLKRAHKRGVELEYILETWSHLD
EDYQELSRQLEVVESSIPSVGLVEESEDRLIDRIALYQHLKSSLNEYQPKLYQVLDDGKR
LLISISCSDLEGQLNQLGEHWLNNTNKVSKELHRLETVLKHWTRYQSESAELIHWLQSAK
DRLEFWTQQSVTVPQELEMVRDHLNAFLEFSKEVDAKSSLKSSVLSTGNQLLRLKKVDTA
ALRSELSHIDSQWTDLLTNIPTVQEKLHQLQMDKLPSRHAISEVMTWISLMENVIQKDEE
NIQNSVGYKAIHEYLQKYKGFKIDINCKQLTVDFVNQSVLQISSQDVESKRSDKTDFAEQ
LGAMNKSWQILQGLVTEKIQLLEGLLESWSEYENNVQSLKTWYETQENRLKQQHRIGDQA
SVQNAMKDCQDLEDLVKAKEKEVERIEQSGLALIQNKKEEVSGIVMSTLRELNQTWANLD
HMVGQLKILLKSVFDQWNNHKVAFDEINTYLMEARYSLSRFRLLTGSLEAVQVQVDNLQN
LQDDLEKQEKNLQRFGSITNQLLKECHPPVTETLTNTLKDVNMRWNNLLEEIAEQLHSSK
ALLQLWQRYKDYSQQCASTVQQQEDRTNELLKAATNKDIADDEAATWIQDCNDLLKGLGI
VKDSLFVLHELGEQLKQQVDASAASAIQSDQLSLSQHLCALEQALCKQQTTLQQKVGVLD
YETFTKSLEALEAWIVEAEDILQGQDPSHSSDLSTIQERMEELKGQMLKFSSMVPDLDRL
NELGYRLPLNDKEIKRMQNLNRRWSLISSQTTERFSKLQSFLLQHQTFLEKCETWMEFLV
QTEQKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIIDGQRLLEQGQVDDRDEF
NLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKWLVEVSYLPVSALGSV
PIPLQQARTLFDEVQFKEKVFLRQQGSYILTVEAGKQLLLSADSGAEAALQAELTEIQEK
WKSASVRLEEQKKKLAFLLKDWENCENGIADSLEKLRTFKKKLSQPLPDHHEELHAEQMR
CKELENVAGSWTDDMAQLTLLKDTLCAYISADDISILNERMELLQRQWEELCHQLSLRRQ
QVSERLNEWAVFSEKNKELCEWLTQMESKVSQNGDILIEDMIEKLKKDYQEEIAVAQENK
IQLQQMGERLARASHESKASEIEYKLGKVNDRWQHLLDLMAARVKKLKETLVAVQQLDKN
MSSLRTWLAHIESELAKPIVYDSCDSDEIQKKLTEQQELQRDIEKHSTGVASVLNLCEVL
LHDCDACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEETWRLWQKFLDDYSRFED
WLKISERTAAFPSSSGVLYTVAKEELKKFEAFQRQVHESLTQLELINKQYRRLARENRTD
SACSLKQMVHEGNQRWDNLQKRVTSILRRLKHFIGQREEFETARDSILVWLTEMDLQLTN
IEHFSECDVQAKIKQLKAFQQEISLNHNKIEHIIAQGEQLIEKSEPLDAAVIEEELDELR
RYCQEVFGRVERYHKKLIRLPLPDDDHDLSDRELELDDSAALSDLHWRDTSADSVLSPQP
SSNPSLSLAQPLRSERSGRDTPASVDSIPLEWDHDYDLSRDLESAVSRTLPSEDEEGQDD
KDFYLRGAVGLSGAPSALESQIRQLDKALDESRFQMQQTENIIRSKTPTGPELDSSYRGY
MKLLGECSGSIDSVKRLEHKLREEEENFPGFVNLNSTETQTAGVIDRWELIQAQALSKEL
RMKQNLQKWQQFNSDLNNIWTWLGETEEELEQLQRLELSTDIQAIELQIKKLKELQKAVD
HRKALILSINLCSSEFTQTDSEKSQDLQDRLSQMNGRWDHVCSLLEEWRGLLQDALMQCQ
DFHEMSHGLLLMLENIDRRKNEIVPIDSNQDAETLQDHHKQLMQIRHELLESQLKVASLQ
DMSCQLLVNAEGTDCLEAKEKVHVIGNRLKLLLKEVSRHIKELEKLLDMSSSQQDLSSWS
SADELDTSGSVSPTSGRSTPNRQRTPRGKCSLSQPGPSVNSPHSRSIKGGSDSSLSEPRP
ARSGRAFLFRVLRAALPLQLLLLLLIGLACLVPMSEEDYSCALSNNFARSFHPMLRYTNG
PPPL
Download sequence
Identical sequences F1PER7
ENSCAFP00000000744 ENSCAFP00000000701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]