SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000005810 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000005810
Domain Number 1 Region: 538-570,651-725
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.69e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000005810   Gene: ENSCAFG00000003891   Transcript: ENSCAFT00000006271
Sequence length 780
Comment pep:known chromosome:CanFam3.1:18:12891951:12941647:-1 gene:ENSCAFG00000003891 transcript:ENSCAFT00000006271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAPRSRLEPPPLPEYSCSYVVSRPVFSELAFQQQHERRLQERKTLRESLARGCSCSRKR
GLGVLKTLLPILDWLPKYRIKEWLLSDIISGVSTGLVGTLQGMAYALLAAVPVGYGLYSA
FFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLSMAPDEHFHTSSGNGTAFNATVIDYAA
RDAARVLIASTLTLLVGIIQLIFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVL
NVSTKNYNGVLSIIYTLIEIFQNVGNTNLADFIAGLLTIIICMAVKEVNDRFKHKIPVPI
PIEVIVTIIATAISYAANLEKNYNAGIVKSIPRGFLPPVLPPVSLFSEMLAASFSIAVVA
YAIAVSVGKVYAIKYDYAIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKT
QIAGIISAGIVMIAIVALGKLLEPLQKSVLAAVVIANLKGMFMQVCDIPRLWRQNKIDAV
IWVFTCIASIILGLDLGLLAGLMFGLLTVVLRVQFPSWNGLGSIPSTDIYKSTTNYKNIE
ELEGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKKGQLRAT
KNGIIRDAGSSNDAFEPDEDTEDPEDPDVPTKEIEIRVDWNSELPVKMNVPKVPIHSLVL
DCGAVSFLDVVGVRSLRMIVKEFQRIDVNVYFASLQDHVIEKLEKCGFFNDNIRKDIFFL
TVHDAVLHLQNQVKSREVQDSILETITLIQDCKDPLELMEAELIEEELDVQDEAMRSLAS
Download sequence
Identical sequences E2RRQ1
XP_005631003.1.84170 XP_540382.3.84170 ENSCAFP00000005810 ENSCAFP00000005810 9615.ENSCAFP00000005810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]