SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014963 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014963
Domain Number 1 Region: 522-554,657-732
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000392
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014963   Gene: ENSCAFG00000010191   Transcript: ENSCAFT00000016179
Sequence length 790
Comment pep:novel chromosome:CanFam3.1:38:2277372:2296022:-1 gene:ENSCAFG00000010191 transcript:ENSCAFT00000016179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPRPRYVVDRAAYSLTLFDDEFEKKERTYPLGEKLRNAFRCSSAKIKAAVFGLLPVLS
WLPKYKIKNYIIPDLLGGLSGGSIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGI
HQMVPGTFAVISILVGNICLQLAPESKFSIFNNATNESYVDTAAMEAERLHVSATLACLT
AIIQMGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYAGPGSIVFT
FIDICKNLPQTNIASLIFAIISGILLVLVKELNARYMHKIRFPIPTEMIVVVVATAISGG
CKMPQKYHMQIVGEIQHGFPTPVSPVVSQWKDMIGTAFSLAIVGYVINLAVGRTLASKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGSYLYPLPKSVLGALIAVNLKNSLKQLADPYYLWKKSKLDCCVWVVSFLSSFFLSLPY
GVAVGVAFSALVVVFQTQFRNGYALAQVMDTDIYVNPKTYNMVREIEGVKIVTYCSPLYF
ANSEIFRQKIIAKTGVDPQKVLLAKQKYLRKQEKGKLPTQQRKSLFMKTKTVSLQELQQD
FENASPTDPNNNQTPANGASVSYITFSPDSSPAAHCEAPASAETPNEPSEMLASVPPFVT
FHTIILDMSGVSFVDLMGIKALGKLSSTYGKIGVNVFLVNIHAQVYNDISHGGVFEEGCL
ERNHVFPSIHDAVLFAQANAREVAPGRDFQGAPSDPELSLYDLEEDSPSYWDLEQEMFGS
MFHAETLTAL
Download sequence
Identical sequences E2RJT1
XP_005640858.1.84170 ENSCAFP00000014963 ENSCAFP00000014963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]