SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000016050 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000016050
Domain Number 1 Region: 644-899
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-56
Family YWTD domain 0.00000523
Further Details:      
 
Domain Number 2 Region: 32-292
Classification Level Classification E-value
Superfamily YWTD domain 1.18e-54
Family YWTD domain 0.00000173
Further Details:      
 
Domain Number 3 Region: 343-573
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-50
Family YWTD domain 0.00000262
Further Details:      
 
Domain Number 4 Region: 946-1205
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-37
Family YWTD domain 0.0000735
Further Details:      
 
Domain Number 5 Region: 1334-1372
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000733
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1255-1295
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 7 Region: 599-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000026
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 902-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000226
Family EGF-type module 0.02
Further Details:      
 
Domain Number 9 Region: 298-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000045
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 1296-1332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 11 Region: 1213-1265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000931
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000016050   Gene: ENSCAFG00000010871   Transcript: ENSCAFT00000017340
Sequence length 1614
Comment pep:known chromosome:CanFam3.1:18:49439447:49516567:-1 gene:ENSCAFG00000010871 transcript:ENSCAFT00000017340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FEMARPGPAWAPSSLCPVSGPHGSLPPPAASPLLLFANRRDVRLVDAGGVKLESTIVVSG
LEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGVAVQNVVISGLVSPDGLACDWVGKK
LYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGM
DGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPF
ALTLSGDTLYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDIQVLSPERQPYFHTRCAE
DNGGCSHLCLLSPREPFYTCACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTPD
FTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGI
AVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSDDLDEPRAIVLHPVMGLMYWTDWGEN
PKIECANLDGQERHILVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLL
EDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVG
TNPCADKNGGCSHLCFFTPHATKCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLE
TNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPE
GMAVDWVGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTQGYIYWTEWG
GKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSDMLGQERVVI
ADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQD
GLNDCMHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTSFLLFSQKCAISRMIP
DDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSPSQSQN
PDRQPHDLSIDIYSRTLFWTCEAANTINVHRLNGDAMGVVLRGDRDKPRAIVVNAERGYL
YFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNRLGKLFWVDADLKRIESCDL
SGANRLTLEDANIVQPLGLTILGKHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTGI
HAVEDVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSP
DQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFQCARGQCVDMSLRCDGEA
DHQDRSEEMTCSAVCLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDTP
AHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYTGANGPFPHEYVSGTPHVPLNFIAPG
SSQHGPFPGISCGKSMMSSVSLMGGRSGVPLYDRNHVTGASSSSSSSTKATLYPPILNPP
PSPATDPSLYNVDVFYSSNIPTTARPYRPYIIRGVAPPTTPCSTDVCDSDYSATRWKASK
YYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences F1PXA0
ENSCAFP00000016050 ENSCAFP00000016050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]