SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000016776 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000016776
Domain Number 1 Region: 759-1061,1100-1154,1198-1253
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.78e-70
Family Calponin-homology domain, CH-domain 0.0015
Further Details:      
 
Domain Number 2 Region: 2887-2977
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000138
Family Motor proteins 0.028
Further Details:      
 
Domain Number 3 Region: 1250-1367
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000832
Family Motor proteins 0.042
Further Details:      
 
Domain Number 4 Region: 1697-1784
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000022
Family Motor proteins 0.072
Further Details:      
 
Domain Number 5 Region: 2211-2299
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000292
Family Motor proteins 0.03
Further Details:      
 
Domain Number 6 Region: 1785-1862
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000504
Family Motor proteins 0.029
Further Details:      
 
Domain Number 7 Region: 1610-1701
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000584
Family Motor proteins 0.023
Further Details:      
 
Domain Number 8 Region: 2078-2149
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000743
Family Motor proteins 0.049
Further Details:      
 
Domain Number 9 Region: 1989-2074
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000119
Family Motor proteins 0.036
Further Details:      
 
Domain Number 10 Region: 2371-2445
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000017
Family Motor proteins 0.032
Further Details:      
 
Domain Number 11 Region: 1859-1933
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000226
Family Motor proteins 0.033
Further Details:      
 
Domain Number 12 Region: 2447-2515
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000929
Family Motor proteins 0.054
Further Details:      
 
Domain Number 13 Region: 2300-2373
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000244
Family Motor proteins 0.04
Further Details:      
 
Domain Number 14 Region: 1516-1605
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000276
Family Motor proteins 0.078
Further Details:      
 
Domain Number 15 Region: 3249-3348
Classification Level Classification E-value
Superfamily ARM repeat 0.00000551
Family Armadillo repeat 0.054
Further Details:      
 
Domain Number 16 Region: 1925-1993
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000292
Family Motor proteins 0.03
Further Details:      
 
Domain Number 17 Region: 2517-2585
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000637
Family Motor proteins 0.049
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000016776
Domain Number - Region: 1457-1520
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000196
Family Motor proteins 0.061
Further Details:      
 
Domain Number - Region: 2151-2223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000319
Family Motor proteins 0.086
Further Details:      
 
Domain Number - Region: 2660-2754
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000407
Family Motor proteins 0.066
Further Details:      
 
Domain Number - Region: 2816-2897
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00398
Family Motor proteins 0.042
Further Details:      
 
Domain Number - Region: 2603-2659
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0085
Family Motor proteins 0.025
Further Details:      
 
Domain Number - Region: 3172-3225
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0743
Family Motor proteins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000016776   Gene: ENSCAFG00000011403   Transcript: ENSCAFT00000018114
Sequence length 3469
Comment pep:known chromosome:CanFam3.1:7:5591545:5660919:1 gene:ENSCAFG00000011403 transcript:ENSCAFT00000018114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRRAGRSWEVSPSGPRPAAGEAAAASPPVLSLSHFCRSPFLCFGDVRLGGSRTLPLLL
HNPNDEAARVEVCRAPAAQQGFSVSPRRFQLQPKEKIVISVNWTPLKEGRVRETVTFLVN
DVLKHQAILLGNAEEQKKKKRSLWGTIKKKKMSASSNNKRISSAQNVNKTFCVSQKADRV
RNPLQACENLDVNEGCSPTENNSLILEENKIPISPISPIFKECNGETSLPLSVRRSTTYI
SLHARENGDLLKVEDASILEDFSFSEKVVNETSFNSTNNINDQTEENCKLILTPACSSTL
NITQSQGNFLSPDSFVKNSRAANNELEVVTCLSSNILMKDNSMPLHLESKSVHENYRKIL
SPDSFINDNYGLNQDLESEPINPILSPNQFVKDNMAYTCIYQQTCKLSLSSNKNSQFSQS
QDPRTNGILPCIPECQSSKSPKATFEEHRALEMKSDCYSFTKNQPKFSAMQDISSCSQDK
LTRRPILSATITKRKSNFTRENQKETNKPKAKRCLNSVAGEFEKVTDNIKEKDGFQSCLP
VIDPVFSKPKSYKIVVTPPSKTTLIARKRRSEGDREDANVRITATGHSEIQEIKRIHFSP
VESKTSVLKKTKKMTTPISKHFNREKLNLKKKTDSRIYRTPNSKTSKKTKPIVAVAQSTL
TFIKPLKTDIPRHPMPFAAKNMFYDERWKEKQEQGFTWWLNFILTPDDFTVKTNISEVNA
ATLLLGVESQHKISVPRAPTKDEMSLRAYTARCRLNRLRRAACRLFTSEKMVKAIKKLEI
EIEARRLIVRRDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETVFGELLSLEDNSDVTGL
AVFILNRLLWNPDIAAEYRHPTVPHLYRDGHEEALSKFTLKKLLLLVCFLDYAKISKLID
HDPCLFCKDAEFKTSKDILLAFSRDFLSGEGDLSRHLSLLGLPVNHVQTPFDEFDFAVTN
LAVDLQCGVRLVRIMELLTRDWNLSKKLRMPAISRLQKMHNVDIVLQILRSQGIQLNDEH
GNAILSKDIVDRHREKTLALLWKIAFAFQVDISLNLDQLKEEIDFLKHTQSMKKMSAQSC
HSDVIINKKKDNRNSGSFEQYSESIKLLMEWVNAVCAFYNKKVENFTVSFSDGRVLCYLI
HHYHPYYVPFDAICQRTTQTIECTQTGSVVLNSSSESDGSSLDLSLKAFDHENTSELYKE
LLENEKKNFQLVRSAVRDLGGIPAMINHSDMSNTIPDEKVVITYLSFLCSRLLDLCKETR
AARLIQTTWRKYKLKTDMKRHQEQDKAARIIQSAIINFLTKRRLKKEISAALAIQKYWRR
FLAQRKLLMLKKEKLEKVQNESASIIQRYWRRYSTRKQFLKLRYYSIILQSRIRMIIAVT
SYKRYLWATVTIQRHWRASLRRKHDQQRYKMLKSSCLIIQSMFRRWKRRKMQLQIKATRV
LQRAFREWHVRKRAKEEKSAIVIQSWYRMHKELRKYVQIRSCVVIIQTRFRCLQAQKLYK
RKKEAILTIQKYYKAYLKGKMERTNYLQKRAAAIRLQTAFRRMKARNLYRQSRAACVLQS
YWRMRQDRFRFLNLKKITTKLQAQVRKHQQLQKYRKIKKAALVIQIHFRAYVSAKKVLAS
YQKTRSAVLVLQSAYRGMQARKKFIHILTSIIKIQSCYRAYISRKRFLRLKNATVKLQSI
VKMRQTRKRYLHWRAASLFIQRWYRSAKLAALKRHQYVQMRESCIKLQAFVRGHLVRKQI
RLQRQAAISLQSYFRMRKKRQYYLEIYKATLVIQNYYRAYKAQVNQRKNFLQVKRAVTCL
QAAYRGYKVRQLIKQQSIAALKIQTAFRGYRERKKYQYVLQSTIKIQRWYRTCRTVRDVR
TQFLKTRAAVISLQCAFRGWKVRKQIRRERQAAVRIQSAFRMAKAQKQFKLLKTAALVIQ
QHLRAWTAGKRQRMEYIELREAALRLQSTWKGKRVRRQVQKQHKCAVIIQSNYRMYVQQK
KWKIMKKAARLIQMYYRAYSIGRKQRQLYLKTKAAAVVLQSAYRSMKVRKKIKECNRAAV
TIQSTYRAYKTKKNYTNCRASAIIIQRWYRGTKIANHQRKEYLNLKKTAVKIQAIYRGIR
VRRHNRHLHMAATVIQAMFKMHQAKMRYHKMRTAAVIIQVRYRAYREGKIQRAKYLTIMK
AITVLQASFRGTRVRQTLRKMQSAATLIQSYYRRHRQQAYFTKLKKVTRTIQQRYRAVKE
RNTQLQRYNKLRHSIICIQAGFRGMKARRHLKSMHLAATLIQRRFRTLRMRRRFLHLRKT
AIWIQRKYRATVCAKHYFQHFVRVQKAVIKIQSSYRGWMVRKKMQEVHRAATAIQAAFRM
HRANVKYQALKHASVVIQQQFRASRAAKLQRQCYLQQRHSALILQAAFRGMKARGHLKNM
HSSATLIQSTFRSLVVRKRFISLKRATVFVQRKYRATICARHHLHQFLKLKKAVITIQSS
YRRLVAKKKLQEMHRAAVLIQATYRMHRTYVTFQTWKHASILIQQHYRTYRAAKLQRENS
VPQRRSALIIQAVYKGMKARQLLREKHRAAIIIQSTYRMYRQYLFYQKIQWATKVIQEKY
RANKKKALQHSALRNAAAACTEADFQDMILRKPTQEQHQAATIIQKHFKASKVRKHYLHL
RANVIFVQRRYRALTAVRTQAVVCTQSSYRSCKVQEDMQHRHLAATRIQSFYRMHRAKLD
YQAKKTAVAVIQNYFRSYIRVKVEREKFLAVQKSVRIIQAAFRGMKVRERLKSLSEVNMV
ASAKQSAFYSCRTEAQCAAVHGSALRTQKWHGASLVTCSQEAEYPQREALVATQRAFCEM
VTRKLETQKCAALRIQYFLQMAVCRRRFVQQKRAAVTLQQYFRTWQTRRQFLLYRKAAVV
LQNHHRAFLSTKHQRQVYLQIRSSIIMIQARTRGFIQKRRFQKIKDSTIKIQAVWRSYKA
RKYLHQVKAACKIQAWYRYWKARKDYLAVLKAVKIIQGCFYTKLERRRFLNVRASTIIIQ
RKWRAILSGRIACEHFLMIKRHQAACLIQANFRRYKGRQVFLRQKSAALTIQRYIRARKA
GKCQRIKYVELKKSTVVLQALVRGWLVRKRILEQRTKIRLLHFTAAAYYHLSALKIQRAY
KRHMAMKNANKQVNAVICIQRWFRTRLQQKRFAQKYPSILTSQHEVPECMSQQNRAASVI
QKAVRRFLLRKKQEKFNNAISRIQSLWRGYSWRKKNDCTKIKAIRLSLQLVNREIREENK
LYKRTALALHYLLTYKHLSAILEALKHLEVVTRLSPLCCENMAQSGAVSKIFVLIRSCNR
SIPCMEVIRYAVQVLLNVAKYEKTTAAVSDVENCIDTLLDLLQMYREKPGDKVADKGGSI
FTKTCCLLAVLLKTTNRASSVRSKSKVVDRIYSLYKLTARKHKMNTERTLYKQKMNSSIS
TPFIPETPVRTRIVSRLKPDWVLRRDNMEEITNPLQAIQMVMDTLGIPY
Download sequence
Identical sequences P62286
ENSCAFP00000016776 ENSCAFP00000016776 NP_001184005.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]