SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017620 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017620
Domain Number 1 Region: 799-975
Classification Level Classification E-value
Superfamily Macro domain-like 1.68e-44
Family Macro domain 0.000077
Further Details:      
 
Domain Number 2 Region: 1190-1382
Classification Level Classification E-value
Superfamily Macro domain-like 3.7e-42
Family Macro domain 0.00076
Further Details:      
 
Domain Number 3 Region: 999-1179
Classification Level Classification E-value
Superfamily Macro domain-like 5.72e-41
Family Macro domain 0.00019
Further Details:      
 
Domain Number 4 Region: 1611-1792
Classification Level Classification E-value
Superfamily ADP-ribosylation 4.32e-37
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.04
Further Details:      
 
Domain Number 5 Region: 1484-1592
Classification Level Classification E-value
Superfamily WWE domain 3.4e-19
Family WWE domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000017620
Domain Number - Region: 224-295
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00272
Family Canonical RBD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017620   Gene: ENSCAFG00000011970   Transcript: ENSCAFT00000019011
Sequence length 1793
Comment pep:novel chromosome:CanFam3.1:33:25763335:25798074:1 gene:ENSCAFG00000011970 transcript:ENSCAFT00000019011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPGSFPLLVEGSWGPDPPESLPTKLQLYFQSARRSGGGACEFLREPGSPPRFLVVFHL
EDVQQRVLERKNHELVWLGKGTFQLTVQLPTAPDEVQDVFEGEIPTKELETKEHVKEPDV
SEELDIKLSLSRRGERMEDTSEECENTSSLVAFENLKANVTDIMLILLVENVSGLSSNDF
KVEVLRDFDVAVVTFQTHTDAVKFVDDCARHHSVKQLQLSPRLLEVTKTIRVENLPPGVN
DYNLKCLFENPQNGGGRVASIECFPEESSALIEFFDKKVLHTIVTKKLEFKHMPLSVFPY
YTSLGTALYGKEKPLIKLPAPFREPLDLPLWRFLQQKNHLIKEINDEARRCHCELIWSKL
SAEVTIRPATTLFCLGRLKIRTWREDVSMAFSSIRSKYKVTTLTVDPTVWDTVRNHLEDD
RILIEFDTLTGTVTLVGKSEDVQNMEPQIKELIESTVQKIKREEQSLEEKVALSPGRYSL
LCHSNALEHLRTECPEVEMCFDKASQHMCFKGFHADVNKAKCEIQKKMDIMVQKSIELPP
EIFQFLQQVDCVEFSKSLLVAQKILAVYELAGTAVVLTGYSSAVLSDAAKQMVTALSYKR
LDLKDGEVLKGRKWKGLTHSLHRRHNSPSRTVIIDELTSETKAEVVIAGCTSQVNETYSL
LFSFVEKHMRVERLIEIEPPIVIDYLRREKKLCWQKMKRTNVQVIFNPENRAQGVLLIGP
QARVLEGVSLLGQVREAVRVESLQVHTPGASRLFREKAPYYRSEVQRRFGCCLELQEAAG
AAGRGDAHRGLPRVELRPGVALAVQRGDLTRFPAAQAVVSPASGDLQLRGGLAAALAQAA
GPALQEDCSRLLRTAGPVPVGGAVASTAGKLPYRLVIHAVGPQWKDSEASRCVSQLKAAV
KQSLRLAEAHGCRSVAIPAISSGLFGFPLAVCVRTIVLAVQESCQLSHDGHALKEIYLVD
TAEKTVQAFADTVTALAEVPGPAAVQPGPTGVHASGQVSLSQGNLRVLLVKGDAQRAAAD
VIVNSVPVNLKLNRGLLSQALLEKAGPKLQEELDMVGRAVAVGMGTVLQTSGCDLHCRYV
LHVVAPDWEEGSTSSQKIMRDIIRKCLEITESLSLRSIAFPAIGTGNLGFPKTIFAELIT
SEVLTFSSKTQLAALQEVQFLLHPNDHENIQAFSHVFARRTNGNVVSDTIPKAEDAQGSY
GTVSSPNVDMHEMKIGPIIFQVASGDITKEEADVIVNSTSKTFNLKAGVSKAILKCAGQN
VEMACSLLAQTGNSDYIVTEGGLLKCKNIIHVIGGNDVKKSISFVLQECEKRNYSSICLP
AIGTGNAQKDPDKVADAIIDAIEDFIQKGMLKSVKKVKVVIFLPHLLDVFYDSMKKREAS
QASPQQSLESKLKSSVSSPSQSPQKQNPLVLKKKTESATFQVCGENVKCMKNALSWIQDL
ITKELCPYTNEDECIKDFNEKEYHKLNELQENLNIAICLDSERPLIEVFGTGNDLTQARN
AIEEMIKGIRLAKEQKSQADFISEFIEWQYYNNGTFHSFDKITNLQLENARKAKKRTTLV
KVNHKSYTVDLVTNIATDTKGHHLPVKRFMKSEVVIPEHWSDMKQQDVCVVELQPGHAEY
DTVATKFNQTCSHLYIEKIERIQNPHLWNSYQTKKKAMDAKNGHKNNEKQLFHGTDADSV
PHVNHNGFNRSYAGKNAAVAYGKGTYFAVNARYSANDTYSRPDINGKKHMYYVRVLTGTY
TRGNQSLIVPPPKSADNPTDLYDTVTDCVQNPGLFVVFYDYQAYPEYLITFTY
Download sequence
Identical sequences F6ULD4
ENSCAFP00000017620 ENSCAFP00000017620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]