SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026784 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026784
Domain Number 1 Region: 253-344
Classification Level Classification E-value
Superfamily TAFH domain-like 4.32e-33
Family TAFH domain-like 0.0000303
Further Details:      
 
Domain Number 2 Region: 652-700
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000001
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026784   Gene: ENSCAFG00000018132   Transcript: ENSCAFT00000028801
Sequence length 862
Comment pep:novel chromosome:CanFam3.1:7:62277152:62402826:-1 gene:ENSCAFG00000018132 transcript:ENSCAFT00000028801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGLTEPAGAAPPAGVSASGPVSMAPAGTLPVRVEGAALALGAVTKAPVSVCVESTASQ
PPRPPVGTVVTKVAPVSALPKLSSGPPLPAPQLVAVKAPNTTTIQLPANLQLPPGTVLIK
SNSGQLMLVSPQQAVTRAETTTNVTSRPAVPTNTHTVKICTVPNSSSQLIKKVAVAPVKK
LAQIGTTVVPTVPKPSSVQSVAVPTSVVTVTSVKPLNSITTLKPSSLGASAAPSNEPSLK
AENSATTQTSLSPAMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLVEQLLDAKIEA
EEFTRQLYVELKSSPQPHLVPFLKKSVIALRQLMPNSQSFIQQCVQQTSNEVVIATCTTT
ATTSPVVTTTVCSIQSEKPVIVSGATTPSTVSVPTLNPLAGPGGAKTGVVTLHSVGPAAV
PGGTTTGTVLLQTPKPLVTSIQNTVTAVSLQPEKPVVSGAAVTLALPSVTFGETSGTALC
LPSVKPVVTSPGTTSDKAVIAPVQIKLAQPGPILSQPAGVPQTVKVKQLVVQQPSGGVAK
QVTTLSHSSALTIQKSGQKKMPVSTAIPTSQFPPASILKQITLPGNKILSLQASPIQKNK
IKENGTSFRDEDDINDVTSMAGVNLSEENACILATNSELVGTLVQSCKDEPFLFIGALQK
RILDIGKKHDITELNSDAVNLISHATQERLRGLLEKLTTIAQHRMATYKASENYILSSDT
RSQLKFLEKLDQLEKQRKDLEEREMLLRVAKSRSNKEDPEQLRLKQKAKELQQLELAQIQ
HRDANLTALAAIGPRKKRPLESGSGSEGLKDNLLASGTSGLTATKQLLRPRITRICLRDL
IFCMEQEREMRYSRALYLALLK
Download sequence
Identical sequences E2RF65
9615.ENSCAFP00000026784 XP_547629.3.84170 ENSCAFP00000026784 ENSCAFP00000026784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]