SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036075 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036075
Domain Number 1 Region: 86-198
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 2.44e-36
Family Frataxin-like 0.00000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036075   Gene: ENSCAFG00000029645   Transcript: ENSCAFT00000045995
Sequence length 211
Comment pep:known chromosome:CanFam3.1:1:88285202:88311676:-1 gene:ENSCAFG00000029645 transcript:ENSCAFT00000045995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTLGRRAAAGLLPRSAPPGSAAAGAGTRGPTRAAPLHGGRGLRVGTGAARGPSHANLSL
HHLNQLVNVKKQSVCLMNMRTVGTVSSPGSLDETTYERLAETTLDSLAEFFEDLADKPYT
LEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDG
VSLHELLATELTKAFKIKLDLSSLAYSGKGT
Download sequence
Identical sequences A6Q0K4
NP_001103428.1.84170 ENSCAFP00000036075 ENSCAFP00000036075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]