SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71908141|ref|YP_285728.1| from Dechloromonas aromatica RCB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71908141|ref|YP_285728.1|
Domain Number 1 Region: 64-105
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000000000129
Family H-NS histone-like proteins 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71908141|ref|YP_285728.1|
Sequence length 105
Comment histone-like nucleoid-structuring protein H-NS [Dechloromonas aromatica RCB]
Sequence
MDLSTLTVSQLRDLQQQIPAEIKRREAQEKVNVLNELRAFAKTRGYAIEELLGKEAKVKA
ATGNKVKVKYRHPQNPELEWTGRGRKPKWVEAWVANGATLESLLV
Download sequence
Identical sequences Q47D23
159087.Daro_2525 gi|71908141|ref|YP_285728.1| WP_011288257.1.67134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]