SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0115077 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0115077
Domain Number 1 Region: 435-564
Classification Level Classification E-value
Superfamily Plus3-like 1.57e-42
Family Plus3 0.0000064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0115077   Gene: FBgn0088925   Transcript: FBtr0116585
Sequence length 781
Comment type=protein; loc=scaffold_13266:complement(7490894..7491000,7491061..7492245,7492313..7493285,7493414..7493494); ID=FBpp0115077; name=Dana\GF11885-PA; parent=FBgn0088925,FBtr0116585; dbxref=FlyBase:FBpp0115077,FlyBase_Annotation_IDs:GF11885-PA; MD5=91be82b124970ea9b56a79697bb33a09; length=781; release=r1.3; species=Dana;
Sequence
MGKRRTQSLMDSNSSDSDSESDTNLESDLMSLAKKRKKPAAAAAKASSRSDSDSDWANNK
AGAPAAKKKKRQKKASRDSSSSESNWDDDSQDEAQPQQQQAPPAQVEHKPQAVAAAAQSA
QLSEAEEGEVSDSDSDKSKSSSSGSGSDSSSSSSSSSDSEFDDGYDDDLMGDDEDRRRLN
GLSEKERETEIYKRIEQREIMRTRWEIERKLKLARRGEKNQEKSKTKGERAKKKKEKREK
KAKKAKESQPPVQPPVAISSLPAVEPKPISEVKAATPMSPPALIREMASTSAAVASILPE
DQASGAGVADYFDHKERSKERKKNVEANKTDDKRSNAMAMLKAKREGKAKREEEEAKRAA
ERDRDDDKEELESVSGCKSAVKLKASEIYSDDSGSSDWDEDEKPTGKRSRSNSSKASSET
EDEEKTTKSPVFISTRDDLNKLRLSRYKMERFVNLPIFEATVLNCFVRISIGNNGQKPVY
RVAEIVGVVETGKIYNLGTTRTNRGLRLKYGSHERVFRLEFISNQEFTENEFNKWVEMCK
ESQVQMPSMDLIEIKANDIKKALNYEFKDEDVDKIVEEKNRFRNRPTNYAMKKTCLMKER
DAAMLRGDYDIAQDLGQQIDELESRASELDKRRSHTLNLISYINDRNRKKNVQDAEKAIM
EEARANKGLKISDPFTRRITQPRMGFKGGKKDEEEMLQAPLPPPPPGKKKANEAGPSNSS
AKPTDSKDYSLYSLHDFDIDLDVPLPVNSTNSVPKPASKPAETVSKRSLNLEDYKKKRGL
I
Download sequence
Identical sequences B3MEU6
7217.FBpp0115077 FBpp0115077 XP_001959745.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]