SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0119895 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0119895
Domain Number 1 Region: 6-254
Classification Level Classification E-value
Superfamily CutC-like 5.75e-60
Family CutC-like 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0119895   Gene: FBgn0093724   Transcript: FBtr0121403
Sequence length 258
Comment type=protein; loc=scaffold_13340:complement(12781136..12781912); ID=FBpp0119895; name=Dana\GF16703-PA; parent=FBgn0093724,FBtr0121403; dbxref=FlyBase:FBpp0119895,FlyBase_Annotation_IDs:GF16703-PA; MD5=418275c4363e6a6c92ebf71f0b2820d3; length=258; release=r1.3; species=Dana;
Sequence
MSSQDIKLEVCVDSIRSAFAAEDGGASRIELCSALGEGGLTPSVGTLKVLKDSLSLPIFC
MLRPRRGTDFVYDDREICAVLMDMDLLRANGADGFVFGSLNPDRSINVEHCRQVMLRSEG
LPVTFHRAFDLTDQKNMHENVQLLKELGFKRILSSGFRPSAAAGADFLAQMIAKHHRDLI
IMPGAGIKVPNLEEILTTTRCREFHASAMDTASEDYVAPTTTRMECDVTMGKQDIDPYYG
TNPNVVRKMVTIASAMSC
Download sequence
Identical sequences FBpp0119895 7217.FBpp0119895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]