SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0121389 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0121389
Domain Number - Region: 192-261
Classification Level Classification E-value
Superfamily CutC-like 0.0157
Family CutC-like 0.024
Further Details:      
 
Domain Number - Region: 43-91
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.018
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0121389   Gene: FBgn0095215   Transcript: FBtr0122897
Sequence length 263
Comment type=protein; loc=scaffold_13340:join(11091871..11091885,11091968..11092744); ID=FBpp0121389; name=Dana\GF18197-PA; parent=FBgn0095215,FBtr0122897; dbxref=FlyBase:FBpp0121389,FlyBase_Annotation_IDs:GF18197-PA; MD5=543be7f46f2a3f2dbae8ed084971d344; length=263; release=r1.3; species=Dana;
Sequence
MRGFIVLCLSAVALAAPQGYNYNPGPSGFGGISTSGGGATFFQGGAPQQVVQSVQAVQPV
QQQAFYQQPAVQTTHHHQQQHQVQQQPQAIVSKRFFIHSAPEEAEDYKERHITVGVPKRN
YNVVFIKSPQRNNKKTIKISPAANEEKTVIYVLSKKGESDVNAEVIEQASSTSKPEVFFI
KYKTNEEAAHAQQQIQAQYDALGGSSQLTDEGVAPVTSVIGALGGSDGHVEAGSGIGATG
AGQIVSTGSAGSHTGNAYLPPNF
Download sequence
Identical sequences B3LXZ0
7217.FBpp0121389 XP_001954285.1.52611 FBpp0121389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]