SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0121924 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0121924
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 1.7e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0002
Further Details:      
 
Domain Number 2 Region: 52-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 3.4e-17
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0121924   Gene: FBgn0095749   Transcript: FBtr0123432
Sequence length 106
Comment type=protein; loc=scaffold_13340:join(19827593..19827664,19827730..19827978); ID=FBpp0121924; name=Dana\GF18732-PA; parent=FBgn0095749,FBtr0123432; dbxref=FlyBase:FBpp0121924,FlyBase_Annotation_IDs:GF18732-PA; MD5=ed15f85a2dd11f7a25faead7022bd452; length=106; release=r1.3; species=Dana;
Sequence
MSYQLYRNTTLGNTLQESLDELIQYGQITPNLAFKVLLQFDKSINNALNQRVKARVTFKA
GKLNTYRFCDNVWTLMLNDVEFREVHEFVKVDKVKIVACDGKSGEF
Download sequence
Identical sequences B3LXP8
XP_001955381.1.52611 XP_017091653.1.53830 7217.FBpp0121924 FBpp0121924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]