SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0125648 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0125648
Domain Number 1 Region: 74-203
Classification Level Classification E-value
Superfamily Plus3-like 1.44e-37
Family Plus3 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0125648   Gene: FBgn0099452   Transcript: FBtr0127156
Sequence length 295
Comment type=protein; loc=scaffold_13248:complement(339298..340185); ID=FBpp0125648; name=Dana\GF22456-PA; parent=FBgn0099452,FBtr0127156; dbxref=FlyBase:FBpp0125648,FlyBase_Annotation_IDs:GF22456-PA; MD5=06b87498a0449823da25771df7de040d; length=295; release=r1.3; species=Dana;
Sequence
MSKNPKDQKATASGRGGVASKAAGHSDVRHVRRPQAEIVRELRRLRASPLRIEDENELWT
GTQEKPPPPDIPIATREQLDQLRLSRYRISQLLVRPAFEQAVTGCFVRVNVNTDEEMPDY
RIGEILGLAELDFGYKVDEIPTNIALRLRYEDLILQHEINDISNLAFTKDEFELWRDNCV
NQAIDPPTTGMVARKRVELYNAMQSEAKALALIRQNFTHAMRPPQRGGILERHGGIYPWR
VQMPKPMIPEPPPLPPPSNPPIGLTYRPILTVIAEEGSEDMHDSDPISIPTDPEP
Download sequence
Identical sequences B3MWF5
7217.FBpp0125648 FBpp0125648 XP_001965425.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]