SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0114262 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0114262
Domain Number 1 Region: 16-145
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.41e-48
Family Calponin-homology domain, CH-domain 0.000000597
Further Details:      
 
Domain Number 2 Region: 359-422
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 4.97e-21
Family EB1 dimerisation domain-like 0.00024
Further Details:      
 
Domain Number 3 Region: 218-273
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000741
Family Calponin-homology domain, CH-domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0114262   Gene: FBgn0088110   Transcript: FBtr0115770
Sequence length 434
Comment type=protein; loc=scaffold_13266:complement(18354036..18354086,18354150..18354222,18354281..18354363,18354418..18354560,18354865..18355123,18355451..18355834,18356069..18356214,18356284..18356436,18356846..18356858); ID=FBpp0114262; name=Dana\GF11070-PA; parent=FBgn0088110,FBtr0115770; dbxref=FlyBase:FBpp0114262,FlyBase_Annotation_IDs:GF11070-PA; MD5=8dc6b6005ec3487f3d21d0220cb10772; length=434; release=r1.3; species=Dana;
Sequence
METAEPHKNQEDTHIMAVNVYSTNVTSENLSRHDMLAWVNDCLQSQFSKIEELCTGAAYC
QFMDMLFPNSVPVKRVKFRTNLEHEYIQNFKILQAAFKKMSVDKIIPVDKLIKGRFQDNF
EFLQWFKKFFDANYDGREYDPVAQRGGLKLGNGNGHGNNGGSGVGSSSNDLHLAHRRPLQ
APTTSSRMAPRLTTNTGMGKDGDLLHRNPLSLAIGCARHFIGLLERTNVKHAIIPIDKLI
KGRFQDNFEFLQWFKKFFDANYDGREYDASAVREGAPMGFGSGAAKPLPGAGTSGVAGSY
RRAAPTTTRPATTSAVKPTVSKVVPRTNNVAPPSRMAAGSNSTGTVKKNDAGNSVSNQQI
EEMSNQVMDMRINLEGLEKERDFYFSKLRDIEILCQEADDGEAHPLIQKILDILYATEDG
FAPPDDAPPEDEEY
Download sequence
Identical sequences 7217.FBpp0114262 FBpp0114262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]