SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0126105 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0126105
Domain Number 1 Region: 542-622
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000373
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0126105   Gene: FBgn0099907   Transcript: FBtr0127613
Sequence length 676
Comment type=protein; loc=scaffold_12911:complement(4575393..4575967,4576029..4577118,4577199..4577564); ID=FBpp0126105; name=Dana\GF22913-PA; parent=FBgn0099907,FBtr0127613; dbxref=FlyBase:FBpp0126105,FlyBase_Annotation_IDs:GF22913-PA; MD5=69039113b26df373e00982341fe6c715; length=676; release=r1.3; species=Dana;
Sequence
MSTLENEVTFRKQAEVSQNLEAQFHSSFTDFILITDHRTSKSKSLEQLEASKDAEDDTSC
CAKYAKNIFRMKTLKRRLPFLTWLPHYNTRDCIGDLIAGFTVGLTVIPQGLAYSGVVGLP
PEYGLYGAFMGCFVYVLLGTCKDSTIGSTAVASLMTFQFAQGSWQRSVLLTFLTGIIEIL
MAIFKLGCLVEFVSGPVSAGFTSAVALIVSTSQMRSMLGVKSEGDSFLATWISMFKDIEH
ARVADTCLGFGCVFLLLAMRSLGKLKIGPKDEGRKSSFHKVFNHVIKFLSTSRNASVVIL
FTLIAMHLEAKGTNPFRLTGEIPKGMPSFSLPPFSIEAQPGNETAGIPPVPGQNFLQMVQ
SMGYGLIIVPLMALLETMSVCKAFAKGKQIDITQEMIACGVGNIGTSLFSGYRCNGGLAR
SAVNNASGCRTNMSNLYIGVIVVLALNFLTDYFAFIPKAVLAAIIISAVIFQVQYQVVTP
MWRSKRSDLVPGILAFVTCLVLPLEIGIMVAIGVNLLFILYYAARPKVTLEQLETQQGTR
FVKITPDRCLIFPSVEFVRNMVLKSGSKSTLPVVIDCTYIYAADYTAAKVISSLVDDFRR
RHQKIIFFNLKPSVVSVFEGLNTKLVLCYNTHALNQELRSDDSDLNRSVDSLDRTESGNG
TSECVSMASTLSLARS
Download sequence
Identical sequences B3MTA0
FBpp0126105 7217.FBpp0126105 XP_001964694.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]