SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082317 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082317
Domain Number 1 Region: 103-224
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.9e-28
Family Canonical RBD 0.00018
Further Details:      
 
Domain Number 2 Region: 20-108
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.16e-24
Family Canonical RBD 0.0000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082317   Gene: FBgn0004237   Transcript: FBtr0082852
Sequence length 325
Comment type=protein; loc=3R:complement(9484189..9484235,9484488..9485370,9486062..9486109); ID=FBpp0082317; name=Hrb87F-PB; parent=FBgn0004237,FBtr0082852; dbxref=FlyBase:FBpp0082317,FlyBase_Annotation_IDs:CG12749-PB,GB_protein:AAN13574.1,REFSEQ:NP_476806,GB_protein:AAN13574,FlyMine:FBpp0082317,modMine:FBpp0082317; MD5=c805895d1cbee816c29de16251ae90df; length=325; release=r5.30; species=Dmel;
Sequence
MAEQNDSNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPK
TKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVG
GLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSI
KNKTLDVKKAIAKQDMDRQGGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGG
AGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSN
GSWGGNGGGGGGGQGGNMGGGNRRY
Download sequence
Identical sequences FBpp0082317 FBpp0082317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]