The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
| Molecular Function |
IC (bits) |
H-Score |
| Biological Process |
IC (bits) |
H-Score |
| Cellular Component |
IC (bits) |
H-Score |
| External link(s) |
Protein: FBpp0082321 Gene: FBgn0086897 Transcript: FBtr0082856 |
| Sequence length |
308 |
| Comment |
type=protein; loc=3R:complement(9462177..9462247,9468021..9468149,9468234..9468477,9468551..9468825,9468891..9468931,9471475..9471641); ID=FBpp0082321; name=sqd-PC; parent=FBgn0086897,FBtr0082856; dbxref=FlyBase:FBpp0082321,FlyBase_Annotation_IDs:CG16901-PC,GB_protein:AAN13570.1,REFSEQ:NP_652209,GB_protein:AAN13570,FlyMine:FBpp0082321,modMine:FBpp0082321; MD5=a6e3fd711c22e26691a388d500c71a99; length=308; release=r5.30; species=Dmel; |
| Sequence |
MAENKQVDTEINGEDFTKDVTADGPGSENGDAGAAGSTNGSSDNQSAASGQRDDDRKLFV
GGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHI
INSKKVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFC
FITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPENQMMGGMRGGPRGGMRGGRGGYGG
RGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYGGGGFNGGKQRGGGG
RQQRHQPY
|
| Download sequence |
 |
| Identical sequences |
A0A0B4K6U6
FBpp0082321 FBpp0301102 NP_001247088.1.81976 NP_652209.1.81976 FBpp0082321 |
