SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0086746 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086746
Domain Number 1 Region: 219-327
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.72e-31
Family Calponin-homology domain, CH-domain 0.0000275
Further Details:      
 
Domain Number 2 Region: 2854-3013
Classification Level Classification E-value
Superfamily Spectrin repeat 5.08e-27
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 3 Region: 3719-3878
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-27
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 4 Region: 3870-3991
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 338-455
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-25
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 4047-4208
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-24
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 7 Region: 4806-4881
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.83e-22
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 8 Region: 3627-3768
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-22
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 9 Region: 2103-2252
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-22
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 10 Region: 2440-2573
Classification Level Classification E-value
Superfamily Spectrin repeat 9.12e-22
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 11 Region: 3395-3548
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-21
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 12 Region: 2966-3115
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-21
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 13 Region: 4273-4394
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-20
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 14 Region: 745-866
Classification Level Classification E-value
Superfamily Spectrin repeat 2.44e-18
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 15 Region: 1621-1766
Classification Level Classification E-value
Superfamily Spectrin repeat 3.17e-18
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 16 Region: 3072-3221
Classification Level Classification E-value
Superfamily Spectrin repeat 3.17e-17
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 17 Region: 4424-4537
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-16
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 18 Region: 3279-3406
Classification Level Classification E-value
Superfamily Spectrin repeat 2.5e-16
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 19 Region: 4491-4613,4665-4695
Classification Level Classification E-value
Superfamily Spectrin repeat 5.52e-16
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 20 Region: 656-787
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000016
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 21 Region: 1821-1944
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000279
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 22 Region: 3547-3662
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000121
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 23 Region: 4715-4825
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000103
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 24 Region: 2633-2791
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000154
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 25 Region: 2367-2468
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000196
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 26 Region: 2009-2143
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000216
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 27 Region: 1508-1617
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000117
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 28 Region: 1376-1499
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000144
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 29 Region: 2222-2344
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000144
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 30 Region: 1302-1408
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000056
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 31 Region: 1153-1255
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000667
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 32 Region: 594-688
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000288
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 33 Region: 994-1143
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000331
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 34 Region: 426-553
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000446
Family Spectrin repeat 0.0097
Further Details:      
 
Weak hits

Sequence:  FBpp0086746
Domain Number - Region: 872-926
Classification Level Classification E-value
Superfamily SH3-domain 0.000128
Family SH3-domain 0.0033
Further Details:      
 
Domain Number - Region: 3229-3286
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0259
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086746   Gene: FBgn0013733   Transcript: FBtr0087620
Sequence length 5160
Comment type=protein; loc=2R:complement(9752859..9753000,9753566..9753631,9753954..9754137,9754207..9754480,9755661..9755854,9757365..9757482,9757548..9757777,9757843..9757960,9758027..9758201,9758345..9758416,9758799..9758843,9759484..9759658,9759714..9761673,9761739..9761964,9762364..9769841,9769906..9770052,9788942..9789077,9789192..9789822,9790159..9791077,9791319..9791687,9791753..9792666,9792727..9793006,9795094..9795723); ID=FBpp0086746; name=shot-PC; parent=FBgn0013733,FBtr0087620; dbxref=FlyBase:FBpp0086746,FlyBase_Annotation_IDs:CG18076-PC,GB_protein:AAM68562,REFSEQ:NP_725338,FlyMine:FBpp0086746,modMine:FBpp0086746; MD5=68297f5bd725d5e77116f87e2d5edd05; length=5160; release=r5.30; species=Dmel;
Sequence
MHSSSQSTLKRTQQLVRQTNGGRGDVLSSGSEVVHSSRGPAITTNIDDSNLRYRHETKRE
RTVEAVITDYPGVSPLGSVPHERTNFERTVTFQDPTGNSRRLSETGALVPAGAIPTSSTH
YQQVTRNKRISTEVLGSSVESTKTSQRAPNGHRRVTTHIVRKVTTLSRAEENAQPAEDLL
PPAKMIRSSELEYRRALPPAIESSSTQRREISDIVVGKEDNVSAREALLRWARRSTARYP
GVRVNDFTSSWRDGLAFSALVHRNRPDLLDWRKARNDRPRERLETAFHIVEKEYGVTRLL
DPEDVDTNEPDEKSLITYISSLYDVFPEPPSIHPLFDMESQRRVHEYRDLAQQFIYWCRE
KTAYLQERSFPPTLIEMKRLLSDLQRFRSDEVSARKREKSKLIQIYKELERYFETVGEVD
VEAELRPDAIEKAWYRMNTALQDREVILQQEIERLERLQRLADKVQREIKHVDQKLTDLE
GRIGEEGRRIERLHPVDAKSIVEALETEIRHLEEPIQDMNQDCHVLNEGRYPHVSELHKK
VNKLHQRWAQLRTNFHTNLVQKLSGLKYPVHETTVTRQTRMVVESRQIDTNPHFRDLQEH
IEWCQNKLKQLLAADYGSDLPSVKEELDRQQHEHKIIDQFHTKILNDERQQTKFSGDELA
LYQQRLNQLQKVYAELLSTSTKRLSDLDSLQHFLGQASAELQWLNEKEQVEITRDWADKQ
LDLPSVHRYYENLMSELEKREMHFATILDRGEALLNQQHPASKCIEAHLTALQQQWAWLL
QLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSDFGLDQGETLLRGMQD
LREELNAFGETVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQGQLQIEKGETVTL
LDNSGRVKWRVRTAKGQEGPIPGACLLLPPPDQEAIDAAERLKRLFDRSVALWQKKHLRL
RQNMIFATIRVVKGWDFDQFLAMGPEQRTAIRRALNDDADKLLSEGDPNDPQLRRLRREM
DEVNRLFDEFEKRARAEEESKQASRIFTEECLAIKSKLEDMARELDQIILAPLPRDLDSL
EHVLEIHSDYERRLHLLEPELKHLQETFRTIALKTPVLKKSLDNLMELWKELNTQSGLHK
DRLKLLEASLAGLEDNEHVISELENELARHQDLPSTAEGLQQVFKQLNHMQDIITQQQPQ
MDKMNDAADQLGRMGVPTKVLGDLKRLHSNVERLNTRWSAVCNQLGERMRSCETAIGLMK
NLQSSVQVEESWVDGTTERLSAMPTATSAYELDQAVFEKFNMCEENVNDLLKWVTTVEQK
ISSVGGPREKIDELRNQINALKQIKDEIESQQRPVATCLEQIRQIVLTGGDVLSAPEVTT
LENSGRELRSRVDRVNDRTVRLLRRLEAGRDELTKLRSELDVFSDWLQVARRTLEDKERS
LSDLTRLPSQADSVREFVSDVIGHQADLRFITMAAQKFVDESKEFLAILNDFRTSLPERL
PHVEPLSSAESPIRQEVSLVSAQYKDLLNRVNALQDRVSGLGGRQREYQDALDKANEWLR
SVHPRVSRIISEPIAGDPKGVQDQMNEAKALHNELLSSGRLVDNAQQALDNLLRSLGGQL
SPMEINQLELPIADLKNNYQQLLDNLGEHCKTLDKTLVQSQGVQDALDSLVGWVNQAEDK
FKMNLRPASLIKERLQEQIREHKVLLADLQSHQASIDSVQVSAKHLLASASNARIAKKVE
SNLNDVTVKFEKLYEKANKRGEFLDDVYNRLSRYLDEISTVEQRMASLQEALDSRETSLL
STEELARRMNELSRDKDQLAPQFEDCVRSGKDLISLRDVTDTGVLRDRIKALESQWRNIN
ISIDERAKLSKQKAEQQLAYEGLKDQVLSWLASTEARVNGLPPVAIDLDRIKQQHDELKP
ICKDYRDYAPTIDKINDIGAQYDALIRPESPARKRSTYSPIKRTSPLRRMSGDARSPSPT
KGGILSPLSTGSSGFGSRRSSQDGFQLSELSPVQQQLSEINNRYGLIGVRLNDRQHELDN
LNEELRKQYENLKGLAQFLERIQRQLPKESVSNKDEAERCIKQARKILEDMYEKQSLLDT
TKAQVKDILRRKSDVPGAEQLRQENDSIQEKWKNLNDICKNRIAFSEKLRDFLDTHGNLK
SWLDSKERMLTVLGPISSDPRMVQSQVQQVQVLREEFRTQQPQLKHFQELGHDVVDHLAG
TPDAQAVEIKLKDILGKWDDLVGKLDDRANSLGGAADSSKEFDAAVNRLREALQNISDNL
DTLPTDGDHQENLRKIENLERQLEGQRPLLADVEQSAATLCNILGDPASRADVNSRVAAL
EKQYLALQKKLDTKKAETEASLRDGRHFAENCSKTLGWLGGELSNLTDRLLVSAHKPTLQ
HQIDTHEPIYREVMAREHEVIMLINKGKDLTDRQQDRGVKRDLDRIQQQWEKLRREAVDR
HTRLQTCMEHCKKYSQTSETFLAWLRTAEDKLADLTPGVLSKAKLETRLRDLQTFRSEVW
KHSGEFENTKGLGETFLSSCDIDKEPIKAELQDIRDRWERLNNDLIARAHEIENCSRRLD
DFNDELRNLDHSLGRCEDRLAAHDALGGAAKDPKLLERVKAIREELTNLSKPLQSLKALA
KDISAEARAAGGDADHLTSEVDGLADRMSELQGRLDDRCGELQSAATAVSQFNEQMKSLG
IDLNDLETEIEKLSPPGREIKIVQVQIDDVGKIQTKLDRLVGRLEDAERAADVLVDAGFA
ADTTQTREQISTLRKTLGRLDNRVRDHEDNLHSTLKALREFYDHQSQTLDDIQDVSDEFK
RMKPVGSELDQIRRQQEDFRNFRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKD
LEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDY
KVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDAL
TDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPTDEEKIQQRIREHD
RLHDEILGKKPDFSDLADVTAQLMHLVSDEEAVNLGEKVRGVTERYTGLVDASDNIGALL
AESRQGLRHLVLSYQDLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHAS
NVESTVESGAELMKHISNDEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFH
EAHNRLVEWMQSAEAALAPSEPRQADVLRLEGELADMRPILDSINQVGPQLCQLSPGEGA
ATIESIVTRDNRRFDSIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREAD
LPAMEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVLRESPQSENTATLREKLDDL
KEIVDTVAQLCSERLGILEQALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQIT
LQQDKNERLLQSIAEHKPLLDKLNKTGEALGALVADDDGAKINEILDTDNARYAALRLEL
RERQQALESALQESSQFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMD
DLDKRQDAFSAVQRAANDVIAKAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLD
DILSVAEPFWKQLNSVMKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPE
VEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHE
TLQNLLKFLTKAEDKFAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVEL
TERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINK
TDSTLDQLKPIPGDPQLLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEAS
TTQEKLRKLNNEWKQLLQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKP
VGGLPETATEQLERFMEVYNELDENRPKVETIQAQGQEYIKRQNQMKVSSSNLQHTLRTL
KQRWDAVVSRASDKKIKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQ
AQMEEHKVLQKDVSTHREAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKA
AERTRALDHGYKEAREFNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKE
THRQLGAKQSVYDGTMRTGKNLLERAPKGDRPVLDKMLIELKEQWTRVWSKSIDRQRKLE
EALLLSGQFSDALGELLDWLKKAKSRLNENGPVHGDLETVQGLCEHHKHIEQDLQKRAAQ
MQGVLKTGRDLERSGNNPEVGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQ
ALFDWLDHAEHKLRYAKNAPDDEKVSREMMDIHMDFMKDLRVREREKTETFEYAEDIINK
AYPDAIPIIKNWLSIIQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEG
TLLNLKHEQLPDEIPPVEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKT
PVFKGSRDQGLNARKGSRITPTRDTPDRDRLPHYGPRFSPSTSGPELEFRSPRAKLLWTK
WRDVWMLSWERQRLLNDHLLYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDK
DNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPDWQERKP
ANDSDKIHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGW
VALDEFLQKNDPCRAKGRTNIELREQFILADGVSQSMAAFTPRRSTPNAAATASSSPHAH
NGGSSNLPPYMSGQGPIIKVRERSVRSIPMSRPSRSSLSASTPDSLSDNEGSHGGPSGRY
TPRKVTYTSTRTGLTPGGSRAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTPSRIPQ
RKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTSTITRKTASGSASPAPTSNGGMSRSS
SIPALTGFGFKPIRRNISGSSTPSGMQTPRKSSAEPTFSSTMRRTSRGTTPTEKREPFRL
Download sequence
Identical sequences A1Z9J2
FBpp0086746 NP_725338.1.81976 FBpp0086746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]