SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111290 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111290
Domain Number 1 Region: 7-62
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000394
Family Cold shock DNA-binding domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111290   Gene: FBgn0085211   Transcript: FBtr0112375
Sequence length 76
Comment type=protein; loc=2L:9436953..9437183; ID=FBpp0111290; name=RpS28-like-PA; parent=FBgn0085211,FBtr0112375; dbxref=FlyBase:FBpp0111290,FlyBase_Annotation_IDs:CG34182-PA,REFSEQ:NP_001097132,GB_protein:ABV53659,FlyMine:FBpp0111290,modMine:FBpp0111290; MD5=16d2fbb986838e7c5cc4c05ef876b9c0; length=76; release=r5.30; species=Dmel;
Sequence
MPQPVASKARVIKILNRIGARGILTEVRVQLVDQPKMQFMRTVKGPVRLGDIVDFEDTEL
TWQSSSRSNSNFEDIC
Download sequence
Identical sequences A8DYY3
FBpp0111290 NP_001097132.1.81976 FBpp0111290 FBpp0111290 7227.FBpp0111290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]