SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0070909 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070909
Domain Number 1 Region: 256-330
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.67e-26
Family GAS2 domain 0.00015
Further Details:      
 
Domain Number 2 Region: 12-74,106-173
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.81e-25
Family Calponin-homology domain, CH-domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070909   Gene: FBgn0029881   Transcript: FBtr0070948
Sequence length 977
Comment type=protein; loc=X:join(6524971..6525138,6538595..6538791,6538861..6538979,6539076..6539371,6542050..6542157,6542218..6542414,6542535..6543175,6543239..6544446); ID=FBpp0070909; name=pigs-PA; parent=FBgn0029881,FBtr0070948; dbxref=FlyBase:FBpp0070909,FlyBase_Annotation_IDs:CG3973-PA,GB_protein:AAF46177.2,REFSEQ:NP_572331,GB_protein:AAF46177,FlyMine:FBpp0070909,modMine:FBpp0070909; MD5=2da1e3bd466510e5d05884937d929377; length=977; release=r5.30; species=Dmel;
Sequence
MAMLEARPYRPFKSSEEYLEAMREDLAEWLSTLYPELSINADNFMDRLDTGVALCKHANY
VRQAAVDYLARRQARNKSMTRSMTSGLAGPILAMGNVHYLPAAKSGTFFARDNVSNFITW
CRKSLKIIECLLFETDDLIMRKNEKHVILCLLEVARRGAKFGMLAPMLVQMERQIDREIA
ADIKANGAGCSENGTQTDALETGNSSAATMTTITTTTVETDLYDDSDDSETEDDGDQNPV
LMYGPQPQIITNDLKSLDEMVRDLVEKCTCPSQFPMVRVSEGKYRIGDTKVLIFVRILRS
HVMVRVGGGWDTLSHYLDKHDPCRCRAQHRSSVAARLIPRQSPNHNPSNGIELHKAQVIF
ERSPPAARRVFNSPNCNGGPGTGSSCGTGVVGVAVPPTLQNGHSLSPNSGKYRSRSPTPQ
RKFLNQQANGGGIASATGSSQTVTTDTSSGQLLGSPSLARRSMSPSPRRLIDMRKKQSSL
DSYSSGPKSLPGYSCSMEEANGGSGVGSAAGGVSSGSAGSGVAGEQGGANKFENISDNGS
EISDEGYRSLGVIQSGAQKRESLHSQASIEDAESNARLDQTSSDSQISPSDEPAEKATTD
ILEEEDLNGQDREEDQEDYSVCDGPQSLPAILSGAHKLSDKFEQSGVFITDDEITVDIAK
TEDQSVANTMGNPTPNLSKIPRSPLAQRRRRSIDNSTCGGAGGSLQDLSSRSGLPAPAFS
RKQPVYRSVRTRNSTGATTTPVAPPRSRQATQLPMVRDVTNTWSGRTTGAPKRRPPCTAD
TFVAPTNGTGPAGSFERNGKGRSSQILYDSNGRRVRSGAPGCTSSLTTSPVKNHASSPLA
QQLLEAASSAKNDAQILEKMKSLLSRYAAGNQTKAGVGATATAANKINSNGKKTPVYEDF
TTAWVHSNGNLERSESCSPPAKARSKRSSAASSCESNNSNAGAGSGAAAGSASVVSPRRE
RGMSKIPAPVRHHTELY
Download sequence
Identical sequences Q9W3Y4
7227.FBpp0070909 FBpp0070909 FBpp0300876 FBpp0070909 FBpp0070909 NP_001245550.1.81976 NP_001284949.1.81976 NP_572331.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]