SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0072164 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072164
Domain Number 1 Region: 92-214
Classification Level Classification E-value
Superfamily TPR-like 4.02e-31
Family Tetratricopeptide repeat (TPR) 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072164   Gene: FBgn0015544   Transcript: FBtr0072256
Sequence length 534
Comment type=protein; loc=2R:join(20046994..20047149,20047203..20047480,20047540..20047748,20047811..20048394,20048452..20048737,20048802..20048893); ID=FBpp0072164; name=spag-PA; parent=FBgn0015544,FBtr0072256; dbxref=FlyBase:FBpp0072164,FlyBase_Annotation_IDs:CG13570-PA,GB_protein:AAF47175.1,REFSEQ:NP_524664,GB_protein:AAF47175,FlyMine:FBpp0072164,modMine:FBpp0072164; MD5=0f93fa61ee8fa6d227e40af8e2ae40c5; length=534; release=r5.30; species=Dmel;
Sequence
MSAQEKAFELQRQVRQNAREYENSVKDLYSWEQDIKNKEKELQKSPLSAANKDLPVRSHV
QTDKSRKESPSSSAASSPTEKQDLPVDPVAQQYKKANDIKDRGNTYVKQGEYEKAIVAYS
TAIAVYPHDPIYHINRALCYLKQESFDQCVEDCEAAIALDKLCVKAYYRRMQANESLGNN
MEALKDCTTVLAIEPKNIEAKRSLARINDRLRKIATKSGPNFTPDRPGMIEILPIEKPAY
KRSKKAMRSVPVVDVVSPRATIDDSNQLRISDEDIDKIFNSNCGIIEEVKKTNPKPTPMP
DTSGPPKAETIAKTSKEVKPTKQTAVKVAPAVETPKETETRKDTKIVPESDNEAKPSAPK
KTAVEVPKVQTQVSPPKTTIERSPEVNTVQTEKIEQASSNNAMSPSPIERFLPPAPTSTA
QFHVTWKELSGPQKYQYLKSIEVPNLCKILGAGFDSDTFADLLRTIHDFFVPNKEPNTAA
VLLEISKNDEFTILAMLMSAEEKKMVSSILNAIKNWPSKNPAVLDNLFKEYGVA
Download sequence
Identical sequences Q9V3E9
NP_524664.1.81976 FBpp0072164 7227.FBpp0072164 FBpp0072164 FBpp0072164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]